KEGG   Acinetobacter baumannii MDR-ZJ06: ABZJ_03106Help
Entry
ABZJ_03106        CDS       T01820                                 

Definition
phosphodiesterase/alkaline phosphatase D
Orthology
K01113  
alkaline phosphatase D [EC:3.1.3.1]
Organism
abz  Acinetobacter baumannii MDR-ZJ06
Pathway
Aminobenzoate degradation
Folate biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Two-component system
Module
Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:abz00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    ABZJ_03106
  Xenobiotics biodegradation and metabolism
   00627 Aminobenzoate degradation
    ABZJ_03106
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    ABZJ_03106
Enzymes [BR:abz01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.1  alkaline phosphatase
     ABZJ_03106
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3184993..3186756)
Genome map
AA seq 587 aa AA seqDB search
MSEKISRRELIQKSLLGFGALSIPVAFTGCNDGSDDESPEIQADFLHGVASGDPLQDKVI
LWTRVTPTDSGVRLKVVWEISTDNQFKQNLKTGMVETSKTDDFTVKVDAAGLQADTVYYY
RFKFGNKVSPVGQTKTLPTSTNKVSFAVCSCSNYPAGYFYVYRELAKQNVDVIIHLGDYI
YEYGADGYATEDATKLGRNLPADNNKEIIKLDDYRKRYALYRQDKDLQAAHQRHPFIVIW
DDHELANDAWREGAENHQSNEGAFSDRKLAALQAYFEWMPIRPVSSTDHLNIYRQFNFGS
LVQLTMLDTRIIARDKQLAYTDYMTATGLDIAKFQADLTNPVRTLMGYTQRDWLVDKLKQ
STATWNVVGQQVLMSKMWIPAELLASLGQITSGGTSPEALAKMNAQITELVALKLRLQQN
DPTLTAQEKARIMMVAPYNLDAWDGYYAEREFVYDKLAEFNKKIIVLAGDTHNAWASYLY
SQKGKYVGVELATSSVSSPGLEKYLSIPLAQLQQFEFAFTTLIDELVYCNLNQRGYLLVT
LDQAQVHSEWRFVDSIKNTEYQIDSSRQNDIVLNLNLMPLKQGQKTA
NT seq 1764 nt NT seq  +upstreamnt  +downstreamnt
atgtcagagaaaatttcacgccgagaattaattcaaaaaagtctgctcggttttggggct
ttatctatacctgttgcttttacaggttgtaatgatggctcagatgatgaaagcccagaa
atacaagcagattttcttcatggtgtcgcaagcggggatccactacaagataaagttatt
ttgtggacacgagtaacaccgacagactctggggtgcgcttaaaagttgtatgggaaatt
tcaaccgataatcagtttaaacaaaatttaaagacgggaatggttgaaacaagcaagact
gatgactttacagtgaaagttgatgcagctgggttacaagcagatacggtgtactactac
cgttttaaatttggtaataaagtttcaccggttgggcagacgaaaacattaccaacatcc
accaataaagtgagctttgcagtatgttcttgttctaactatcctgcgggttacttttat
gtttatcgtgaactggcaaaacagaatgttgatgtcattattcacttgggtgactatatt
tatgaatatggggcagatggctatgcgacagaagatgcaaccaagttaggccgtaattta
cctgccgataataataaagaaattattaaattagatgattaccgcaaacgttatgcgctt
tatcgtcaagataaagatttgcaagcagctcatcagcgccatccttttattgtgatttgg
gatgaccatgagttggcaaatgatgcttggcgtgagggggcggaaaaccatcaaagtaat
gaaggggccttttcggaccgtaaattagctgccctacaggcctattttgaatggatgcca
attcgtccagtttctagtacagatcatttaaatatttatcgccagtttaattttggctct
cttgttcagttaaccatgctagatacgcgtattattgcgcgtgataagcagcttgcatat
acagactatatgacggctacaggcttggatattgcaaagtttcaggcagatttaactaat
ccggtgcgtactttgatgggatatacgcaaagagattggttggtcgataaattaaagcaa
tctacagcaacatggaatgtagtaggacagcaagtattaatgagtaaaatgtggattcca
gctgagttgttggcgtctttagggcaaattacttcaggaggaacttcgcctgaggcgctt
gctaagatgaatgcacaaattaccgagttagtcgctttaaaacttcgtttacaacaaaat
gatccgacattaacagcccaagaaaaagcaagaattatgatggttgcgccatataatctc
gatgcttgggatggttactatgctgagcgagagtttgtgtacgataaattggcagagttt
aataaaaagatcattgtgttagccggggatacacataatgcatgggcatcttatttatat
agccagaaagggaaatatgttggagttgaattagcgaccagttctgtatcgtctccaggt
ttagaaaaatatttaagtattccactggctcagcttcaacagtttgaatttgcatttact
acattaattgatgaattggtttattgtaatttaaatcaacgaggatatctgttggttact
ctagatcaggcgcaagttcattctgagtggagatttgtagattcaattaaaaataccgaa
tatcagatagattcaagccgacaaaacgatattgtattgaatctaaatttgatgccgtta
aaacaaggtcaaaagactgcttga

DBGET integrated database retrieval system