KEGG   Acinetobacter baumannii MDR-ZJ06: ABZJ_03139Help
Entry
ABZJ_03139        CDS       T01820                                 

Definition
succinate dehydrogenase, hydrophobic subunit
Orthology
K00242  
succinate dehydrogenase membrane anchor subunit
Organism
abz  Acinetobacter baumannii MDR-ZJ06
Pathway
Citrate cycle (TCA cycle)
Oxidative phosphorylation
Butanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:abz00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    ABZJ_03139
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    ABZJ_03139
   00650 Butanoate metabolism
    ABZJ_03139
  Energy metabolism
   00190 Oxidative phosphorylation
    ABZJ_03139
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3231461..3231841)
Genome map
AA seq 126 aa AA seqDB search
MDYVLMKSATGLTGSGSRDWFIQRVSAVVLAAYTVVLFGWILCKGGFDYQQWAGFMMTLP
MKIFSLLAILSLIAHAWIGMWQVFTDYVTTRQMGPSAKGLRLVLTTAVIIAVFVYAIWGI
QIFWAN
NT seq 381 nt NT seq  +upstreamnt  +downstreamnt
atggattatgttctaatgaaaagtgctacaggtttaacaggttcaggttctcgtgattgg
tttatccagcgtgtaagtgctgtggtattggcagcttatactgttgttctttttggttgg
atcctctgcaaaggcggatttgactatcaacaatgggctggcttcatgatgacattacca
atgaagattttctctttattggcaattttgtcgcttatcgcacacgcatggattggtatg
tggcaggtttttactgactatgtcactactcgtcaaatgggtccttcagcgaaaggttta
cgccttgtactgactacggctgtcattattgcagtgtttgtgtacgcaatctggggtatc
cagattttctgggcgaattga

DBGET integrated database retrieval system