KEGG   Acinetobacter baumannii MDR-ZJ06: ABZJ_03152Help
Entry
ABZJ_03152        CDS       T01820                                 

Definition
alcohol dehydrogenase
Orthology
K00001  
alcohol dehydrogenase [EC:1.1.1.1]
Organism
abz  Acinetobacter baumannii MDR-ZJ06
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:abz00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    ABZJ_03152
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    ABZJ_03152
  Lipid metabolism
   00071 Fatty acid degradation
    ABZJ_03152
  Amino acid metabolism
   00350 Tyrosine metabolism
    ABZJ_03152
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    ABZJ_03152
   00626 Naphthalene degradation
    ABZJ_03152
Enzymes [BR:abz01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     ABZJ_03152
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3242330..3243514
Genome map
AA seq 394 aa AA seqDB search
MAKPYYEFFCPVKVIAGNAALEHIPFELATLGAKRPLIITDKGVRANGLLNPIEAAFSTT
DAVIGHVFDDVPPDSSLEVVRLAAEAYRTNKCDAIIAVGGGSVIDTSKATNILVSEGGDD
LLQYSGAHNLPKPLKPFFVIPTTSGTGSEVTMVAVVSDTQKNVKLAFASYYLMPHAAILD
PRMTLTLPPHLTAMTGMDALTHCVEAYTCMAANPLSDAYASAGIKKISENLFNVLENPND
SQGRLELAQASTMAGIAFSNSMVGLVHSLGHALGAVAHLPHGLCMNLFLPYVLEYNKQVN
GQKIGELLLPLAGADIYAQTPATQRADRAIATILAMRDRLFSLTKLPRTLRETGKVTEAQ
LDEVAEKALNDGSIIYNPKEASLKDLREILQKAW
NT seq 1185 nt NT seq  +upstreamnt  +downstreamnt
atggctaaaccatattacgaattcttttgtcctgtaaaagtcattgccggtaatgctgct
ttagaacatattccgtttgaacttgcgactttaggtgcaaaacgccctcttatcattacc
gataaaggtgttcgtgcaaatggcttgttaaaccctattgaagctgcttttagcacaact
gatgcagtcattggtcatgtttttgatgatgttccaccagactcaagccttgaagttgtt
cgacttgccgcggaagcttatcgcacaaataaatgtgatgcgattattgctgtgggtggt
ggttctgttatcgatacctctaaagcaactaacattttagtatcagaaggtggagatgat
cttcttcaatattctggtgcacacaacctaccaaaaccattaaaaccatttttcgtcatc
ccgactacatcaggtacgggctctgaagtgaccatggttgctgttgtgtctgatacacaa
aagaatgttaaattggcatttgcttcatattacttaatgccacatgctgcgattttagat
ccacgcatgacattaacgttaccacctcacttaactgcaatgacgggcatggatgcatta
acacattgtgttgaagcatacacctgtatggcagctaacccgcttagcgatgcctatgca
agtgcaggtattaaaaaaattagcgaaaacctatttaatgtcttagaaaatccaaatgac
tcacaaggtcgtttagaacttgcacaagcttctacaatggcaggtatcgcattctctaac
tcgatggtaggccttgtacactcattaggacatgcattaggtgcagttgctcacctgccc
cacgggctgtgcatgaacttattcttaccttatgtgcttgagtacaataaacaagtcaat
ggtcagaaaattggcgagttgctattaccacttgcaggtgcggatatttatgcccagact
cctgctactcagcgtgcagacagagcaatcgcaactattttagcaatgcgtgatcgttta
tttagcttaaccaaattaccacgtaccttacgtgaaacaggtaaagttactgaagcacag
cttgatgaagtggcagagaaagcactaaatgatggctcaattatttataatcctaaagaa
gcaagcttaaaagatctacgagagatcttacaaaaagcttggtaa

DBGET integrated database retrieval system