KEGG   Acinetobacter baumannii MDR-ZJ06: ABZJ_03240Help
Entry
ABZJ_03240        CDS       T01820                                 

Definition
(GenBank) acetylornithine deacetylase/succinyl-diaminopimelate desuccinylase
  KO
K01439  succinyl-diaminopimelate desuccinylase [EC:3.5.1.18]
Organism
abz  Acinetobacter baumannii MDR-ZJ06
Pathway
abz00300  Lysine biosynthesis
abz01100  Metabolic pathways
abz01120  Microbial metabolism in diverse environments
abz01230  Biosynthesis of amino acids
Module
abz_M00016  Lysine biosynthesis, succinyl-DAP pathway, aspartate => lysine
Brite
KEGG Orthology (KO) [BR:abz00001]
 Metabolism
  Amino acid metabolism
   00300 Lysine biosynthesis
    ABZJ_03240
Enzymes [BR:abz01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.18  succinyl-diaminopimelate desuccinylase
     ABZJ_03240
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_M20 M20_dimer DUF3859
Motif
Other DBs
NCBI-ProteinID: AEP07700
UniProt: G2JME7
Position
3334491..3335627
Genome map
AA seq 378 aa AA seqDB search
MNHSDTLSLSLELLQQPSVTPIDHTCQTIIAERLAKVGFHIEPMRFGDVDNLWARRGTEG
PVFCFAGHTDVVPTGRLDAWNSDPFAPEIRDGKLYGRGSADMKTALAAMVVASERFIAKH
PNHKGSIAFLITSDEEGPAVNGTVKVIETLEKRNEKITWCLVGEPSSTHKLGDIVKNGRR
GSLNAVLKVQGKQGHVAYPHLARNPIHEASPALAELCQTVWDNGNEYFPATSFQISNIHA
GTGATNVIPGALEVTFNFRYSTEVTAEQLKQRVHEILDKHGLQYEIVWNLSGLPFLTPVG
ELVNAAQTAILNVTGTETELSTSGGTSDGRFIAPTGAQVLELGVLNATIHQINEHVDVHD
LDPLTDIYEQILENLLAQ
NT seq 1137 nt NT seq  +upstreamnt  +downstreamnt
atgaaccactcagacactctctcgcttagcttagaacttttacaacagccttctgttact
cctattgatcatacttgccaaactattattgctgagcgcttagctaaggttggcttccat
attgaacctatgcgctttggagatgtcgataatttatgggctcgacgtggaaccgaaggc
cctgtattttgttttgctggtcataccgacgtagtaccaacaggacgtttagacgcttgg
aattcagacccatttgcaccagaaattcgcgatggcaaattatatggtcgtggttcagca
gatatgaaaactgcattagctgcaatggtagttgcatctgaacgttttatagcaaaacac
ccaaaccataaaggttcaattgcttttttaattacttcagatgaagaaggtcctgctgtt
aacggtacagttaaagttatcgaaacactggaaaagcgtaatgaaaaaattacttggtgt
ttggttggggaaccatcaagtactcataaattaggtgatattgttaagaatggccgtcgt
ggttctcttaatgctgtattgaaggttcaaggcaaacaaggtcatgtagcttacccacac
ttggcacgtaatccaattcatgaagcatccccagcgttagctgagttgtgccaaacagtt
tgggacaatggcaatgagtatttccctgcaacttcattccagatttcaaatatccatgca
ggtactggcgcaaccaatgtaatccctggtgctttagaagttacttttaatttccgctat
tcaaccgaggttacagcagaacagcttaaacaacgtgttcatgaaattttagacaagcat
ggcttgcaatatgaaattgtctggaatttgtctggcttaccattcttaactccagtaggt
gaattagttaacgcagctcaaactgctattttaaatgtgactggtactgagactgagctt
tcaacaagtggtggtacatctgatgggcgcttcattgctccaacaggtgcacaagtttta
gaactcggtgttctaaacgcaactatccatcaaattaatgaacatgttgatgtacatgat
cttgatccattaactgatatttatgagcaaattttagaaaatttattagctcaataa

DBGET integrated database retrieval system