KEGG   Acinetobacter baumannii MDR-ZJ06: ABZJ_03300Help
Entry
ABZJ_03300        CDS       T01820                                 

Definition
tryptophan synthase subunit alpha
Orthology
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
abz  Acinetobacter baumannii MDR-ZJ06
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:abz00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    ABZJ_03300
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    ABZJ_03300
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    ABZJ_03300
Enzymes [BR:abz01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     ABZJ_03300
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3403247..3404050)
Genome map
AA seq 267 aa AA seqDB search
MSRLATRFEKLQSQQRKALVSYVMAGDPQPQVTVPLLHKMVAAGVDVIELGLPFSDPMAD
GPVIALAAERALAAGTNTLDALNMVKEFREQDQETPVVLMGYLNPVEVIGYEKFVSYAKQ
CGVDGLLLVDLPPEESKEFGAILKQHDMDQIFLLAPTSTDQRIQHVANQASGFIYYVSLK
GVTGAATLDTSEAAARIEKIKGMTNVPVGVGFGISDAASAKAMGSVADAVIVGSAFVKSF
ATLAADEAVEQTVNKVKELRAALDELV
NT seq 804 nt NT seq  +upstreamnt  +downstreamnt
atgtcacgtcttgccacccgttttgaaaagctgcagtcccaacaacgtaaagcgcttgta
tcttatgtcatggcgggtgatccacagccacaagtaacggtgccgttacttcataaaatg
gttgcggcaggagtagacgtcattgagcttggtttaccattttcagacccgatggctgat
ggtccggtaattgcacttgctgctgaacgcgcacttgcggctgggacgaacaccttagat
gcgctgaacatggtaaaagagtttcgtgagcaggatcaggaaacacctgtagttttaatg
ggttatcttaatcctgttgaagtgattggttacgagaagtttgtttcttatgcgaaacaa
tgtggtgtagatggcttattacttgtggacttaccaccggaagagtcaaaagaatttggt
gcaatcttgaaacaacatgatatggaccagattttcttacttgcaccaacttcaactgat
caacgtattcaacacgtagcgaatcaggcaagcgggtttatctactatgtttcactcaaa
ggtgtaacaggtgcagcgactttggatacttctgaagcggctgcacgtattgaaaaaatc
aaaggtatgactaacgttccagttggcgttggtttcggaattagtgatgctgcttcagcg
aaagccatgggtagtgttgcagatgccgtgattgtaggtagtgctttcgttaaatctttt
gcaacgttggcagctgatgaagctgttgaacagacggtgaataaagtcaaggagcttcga
gcagcgctcgatgagttagtatga

DBGET integrated database retrieval system