KEGG   Acinetobacter baumannii MDR-ZJ06: ABZJ_03312Help
Entry
ABZJ_03312        CDS       T01820                                 

Definition
putative fatty acid desaturase
Orthology
K00507  
stearoyl-CoA desaturase (delta-9 desaturase) [EC:1.14.19.1]
Organism
abz  Acinetobacter baumannii MDR-ZJ06
Pathway
Biosynthesis of unsaturated fatty acids
Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:abz00001]
 Metabolism
  Overview
   01212 Fatty acid metabolism
    ABZJ_03312
  Lipid metabolism
   01040 Biosynthesis of unsaturated fatty acids
    ABZJ_03312
Enzymes [BR:abz01000]
 1. Oxidoreductases
  1.14  Acting on paired donors with incorporation of molecular oxygen
   1.14.19  With oxidation of a pair of donors resulting in the reduction of O2 to two molecules of water
    1.14.19.1  stearoyl-CoA 9-desaturase
     ABZJ_03312
Lipid biosynthesis proteins [BR:abz01004]
 Desaturase
  First
   ABZJ_03312
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3414215..3415417
Genome map
AA seq 400 aa AA seqDB search
MTRFLGALPDMTSAPLKAPINWTASITLIGLPILAAIIIPIYAYYYDFSVSAWVSLFFLL
ALSSMGITAGYHRLWAHRAYEASLPLKILLMIGGTFAVQNSILFWASGHRTHHRHVDDVD
EDPYSIERGFWYAHMGWMIRDHSPSEPDFKNAPDLLNDKLVMFQHKYYALMVVAVHVGIL
GLVGWATGDLWGVVLLGGLLRLIISHQVTFFINSLCHMFGKRPYTDENSARDNFWLAIAT
WGEGYHNYHHIFQYDYRNGVKWWQYDPTKWLIWTCSKIGLAKNLRRIPSFNIKKAELAMK
FKYAEQDLAIYGHDVNADISQMKQRIAQEYEAFTHTLNDWAKLKEQELQAKKAAMAEKIH
KMDHKLKVDFQLLEHRLSHHRECLETLMRNIKKNTNVVPD
NT seq 1203 nt NT seq  +upstreamnt  +downstreamnt
atgacaaggtttctaggagcgctgccggatatgacttccgccccactcaaggccccaatt
aactggaccgctagcattaccttaattggtttaccaattcttgctgcaatcataatcccg
atttatgcgtattattatgattttagtgtaagcgcatgggtaagcttattttttctttta
gctttaagtagcatggggattactgctggttaccatcgtctttgggcacatcgtgcttat
gaagcgtcgttaccacttaaaattcttttaatgattggcggcacatttgctgtacaaaac
agtattctgttttgggcatctggtcaccgtacccatcaccgtcatgtcgacgatgtagat
gaagatccatattcaattgaacgtggcttttggtatgcccatatgggttggatgatccgc
gatcattctccatctgaaccagattttaaaaatgcaccagacttactcaatgacaaactg
gtgatgttccaacataaatactacgccttgatggtcgtagcggttcacgttggtatttta
ggtttggttggctgggcaactggcgatttatggggtgttgtacttcttggtggtctatta
cgtttaatcattagccatcaagttacattcttcatcaactcactttgccacatgttcggt
aaacgcccttataccgatgaaaactcagcacgcgataacttctggttagcgattgcaact
tggggtgagggttaccacaactatcaccatattttccagtacgactatcgtaatggtgtg
aaatggtggcaatatgatccaacaaaatggctaatctggacatgctctaagattggttta
gcaaagaacctacgtcgtattccaagctttaatattaaaaaagcagaattggcaatgaag
tttaaatatgctgaacaagacttggctatttatggtcatgatgtaaatgccgacattagt
caaatgaagcaacgtattgctcaagagtatgaagcatttacacatactttaaatgactgg
gcgaaactcaaagaacaagagttacaagcaaagaaagcagcaatggctgaaaagattcac
aaaatggatcacaagttaaaagttgatttccaattgcttgaacatcgtttgagtcatcac
cgtgagtgtttagaaactttaatgcgtaacattaaaaagaacacaaacgtcgtaccagac
taa

DBGET integrated database retrieval system