KEGG   Acinetobacter baumannii MDR-ZJ06: ABZJ_03716Help
Entry
ABZJ_03716        CDS       T01820                                 

Definition
(RefSeq) dihydrolipoamide S-acetyltransferase, E2 component of the pyruvate dehydrogenase complex
  KO
K00627  
pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
abz  Acinetobacter baumannii MDR-ZJ06
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:abz00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    ABZJ_03716
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    ABZJ_03716
   00020 Citrate cycle (TCA cycle)
    ABZJ_03716
   00620 Pyruvate metabolism
    ABZJ_03716
Enzymes [BR:abz01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     ABZJ_03716
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3828043..3830022)
Genome map
AA seq 659 aa AA seqDB search
MQIKTPDIGVDKANVAEILVKVGDRVEVDDSIVVLESDKATVEVPSTSAGVVKSILINQG
DDVTEGVALIEIEAEGAAQAAPEPTPAPAAEKPAAPAPAQQTQASAQPAATSSATVEVTV
PDIGVEKALVGEILVKVGDQIDVEQSIVVVESDKATVEVPSSVAGTVESIQVKEGDTVKE
GVVLIQVKTAAASNAQAEAPATTPAPAAVAEPVAAKQETVAAAPAQSGSVDINVPDLGVD
KAVVAEILVQVGDKVDVDQSLVVVESDKATVEVPSTVAGVVKAIHLQAGQQVSQGVLLAT
IEAEGQAPAAAPAAKAEAAPAPQAAAPKAAAPIATQSAPAAPTSGTDKLTKEQEAENAKV
YAGPAVRKLARELGVILSQVKTSGEHGRVVKEDIFAYVKSRLTAPQAAPVAQATAAPAGL
PSLPDFTAFGGGEVKPMTRLQQVSVPQLSLNNYIPQVTQFDLADITELEAWRGELKDGFK
KQGVSLTILAFIAKAVAHLLKEEPYFAGHLADDQKSVLLRNEIHMGIAVATPDGLTVPVL
RNPDQKSIKQIAVELGDLSKKARDKKLTPKDLQGANFTITSLGSIGGTAFTPLVNWPQVA
ILGISPATMQPVWNGKDFDPRLMLPLSLSYDHRVINGADAARFTNKLTKLLKDIRTLLI
NT seq 1980 nt NT seq  +upstreamnt  +downstreamnt
atgcaaattaagacccctgatattggtgtagataaagcaaacgtcgctgaaattttagta
aaagttggcgaccgtgttgaagttgacgacagtatcgttgtgcttgagtctgataaagca
actgttgaagtgcctagcacttcagcaggtgtcgtaaaaagtatcttgattaatcaaggt
gatgatgtgactgaaggtgttgctttgattgagatcgaagcagaaggtgcggcacaagca
gcaccggaaccaacaccagctcctgcggctgaaaagccagctgctccagcacctgcgcaa
caaactcaagcttcagctcaacctgctgctacatcaagtgcaactgttgaagtgactgta
cctgacatcggtgttgaaaaagcattggttggtgaaatcctcgttaaagtgggtgaccag
atcgatgttgaacaaagtattgtggttgtagagtcagataaagcgactgtagaagttcca
agtagtgttgctggtactgtagaaagtattcaagtgaaagaaggcgataccgttaaagaa
ggtgttgttcttattcaagtgaaaacagcagctgcatctaatgcgcaagcagaagctcct
gctactacaccagctccagctgcggtagcagaaccggttgctgcaaagcaagaaactgtg
gcagcggctccagctcagtctggttcagttgatatcaatgttcctgatttgggtgtagat
aaagctgttgttgctgaaatcttggttcaagttggtgataaagttgatgtagaccaaagc
cttgttgttgttgagtcagataaagcaactgtagaagttccaagtaccgttgctggtgtt
gtaaaagcaattcacttgcaagcaggccaacaagtttcacaaggtgtattgcttgcaaca
attgaagctgaaggccaagcacctgctgctgcaccagcggcaaaagcagaagcagcccca
gctccacaggcagcagcacctaaagcagccgctcctattgcaactcagtctgcacctgcg
gcgcctacatctggtactgataagttaacgaaagagcaagaagcagaaaacgctaaagtg
tatgctggtcctgctgttcgtaagctggctcgtgaacttggtgtgatcttgtcacaagtt
aaaacttctggtgagcatggccgtgttgttaaagaagatatctttgcttatgtgaagagc
cgtttaactgcgccgcaagctgcaccagtagctcaagctactgctgctccggctggattg
ccgtcattacctgactttactgcttttggtggcggtgaagtaaaaccaatgacacgttta
cagcaagtttctgtaccgcagttgtctttaaacaactacattccacaagtaactcagttt
gaccttgcggatattactgagctagaagcttggcgtggtgagctgaaagacggctttaag
aaacaaggtgtgagcctaacaattttggcatttattgcaaaagcagtagcacacttgttg
aaagaagagccttattttgcgggtcacttagcagatgatcagaaatctgtattgctccgt
aatgaaatccatatgggtattgcggttgcaactccagatggtttgaccgtgcctgtacta
cgtaatcctgaccaaaaatcaattaagcaaattgctgttgaattaggtgatttgagtaaa
aaagcgcgtgataagaaattaacgccgaaagatttacaaggtgctaacttcacgatcaca
agcttgggctcaattggcggtacagcatttacgccactagttaactggccacaagttgca
attttgggtatttcacctgcaacgatgcagcctgtatggaatggtaaagactttgatcca
cgcttaatgttgccgttgtcattgtcttatgaccaccgtgtaattaatggtgcggatgca
gcgcgctttacaaataaacttacgaaacttcttaaagatattcgtactttattaatctaa

DBGET integrated database retrieval system