KEGG   Acinetobacter baumannii MDR-ZJ06: ABZJ_03808Help
Entry
ABZJ_03808        CDS       T01820                                 

Definition
bifunctional protein GlmU
Orthology
K08281  
nicotinamidase/pyrazinamidase [EC:3.5.1.19 3.5.1.-]
Organism
abz  Acinetobacter baumannii MDR-ZJ06
Pathway
Nicotinate and nicotinamide metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:abz00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00760 Nicotinate and nicotinamide metabolism
    ABZJ_03808
Enzymes [BR:abz01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.19  nicotinamidase
     ABZJ_03808
    3.5.1.-  
     ABZJ_03808
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3931021..3931665)
Genome map
AA seq 214 aa AA seqDB search
MKMNKQPQNSALVVVDVQNGFTPGGNLAVADADTIIPTINQLAGCFENVVLTQDWHPDNH
ISFAANHPGKQPFETIELDYGSQVLWPKHCIQGTHDAEFHPDLNIPTAQLIIRKGFHAHI
DSYSAFMEADHSTMTGLTGYLKERGIDTVYVVGIATDFCVAWTALDAVKQGFKTLVIEDA
CKGIDLNGSLEQAWQTMQQQGVVRIQSTDLLNEC
NT seq 645 nt NT seq  +upstreamnt  +downstreamnt
atgaaaatgaataaacaaccacaaaattcggctttagtcgtagttgacgtgcaaaatggt
tttacccctggcggaaacctagcagttgccgacgctgatacgattattccaaccattaac
caattggcaggttgttttgaaaatgtagtcctcactcaagactggcatccggataatcat
atttcttttgcagccaaccatccgggcaagcagccatttgaaacgattgaactggattat
ggatcacaggtgctttggcctaagcattgtatacaaggcactcatgatgccgaatttcat
ccggatttaaatatcccgacagctcaactgattatccgaaaaggttttcatgctcatatt
gatagttactcggcttttatggaagccgaccactcaacaatgacaggtttaactggttac
ttaaaagaacgtggtattgatacggtctatgtggtcggaattgctacagacttttgtgtc
gcatggactgctttagatgcggttaagcaaggctttaaaactttagtaattgaagatgcg
tgcaaaggtattgatcttaatggttcattagaacaagcgtggcaaactatgcagcaacaa
ggtgttgttcgtattcaatcgactgatctgttgaatgaatgctag

DBGET integrated database retrieval system