KEGG   Acidobacterium capsulatum: ACP_0029Help
Entry
ACP_0029          CDS       T00868                                 

Definition
glycosyl hydrolase family protein
Orthology
K12373  
hexosaminidase [EC:3.2.1.52]
Organism
aca  Acidobacterium capsulatum
Pathway
Other glycan degradation
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:aca00520]
Metabolism; Glycan biosynthesis and metabolism; Other glycan degradation [PATH:aca00511]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
38320..40380
Genome map
AA seq 686 aa AA seqDB search
MLVSSSALCEAQSSHSTFTFHNTLMPEPSSLQAGKGYLVLTPQFAATTGKFHDPRLDHAI
ERAMSQLKQETGVLIPVDVQSASEVSHPVFSISVDGPGEKVQSVDENESYSLTVTSQSVH
LQAATDVGAMHGLQTLLQLVQHTDTQYFLPAVTIHDSPRFPWRGLMLDCSRHFEPIPVIK
RTLDAMAAVKMNVFHWHLSDDQGFRIQSKAFPLLTQRGSDGDFYTQAQAREIVAYARARG
IRVVPEFDMPGHTSSWFVGYPNLASASGPFHIERHFGVFDPVMDPTRASTYVFLDKFIAE
MASIFPDPYMHIGGDENNGVEWKHNPRIQAFMRAHNLKGTAALQAYFNRRLLKILQKYHK
HMIGWDEVLAPGLPTDVMIQSWRGYDSLASAARKGYTGILSSGYYLDSMQTAAEHYAVDP
IPSSSTLTPEQRKRILGGEACMWGEYVNSNIIDSRVWPITAAIAERLWSAQSVNNVNDMY
RRLRVESLRIEALGLTQISQEDASLRQLAGTQKITQLKVLAATLEPATFDQRDQYTLQHN
VTQQTPLDHLVDALRPDPPFRHDFEQLVQRYLDHPDANSKQNQRLRMLMETWVTQQDRVS
EQMRHSPRLAPAQIRSVQLGQMGSMGLQAIGYLGTGKTPPPGWEAAQVALLKQAAEPIDL
TRFDIMKPMQMLVEAASGKHAAAAAH
NT seq 2061 nt NT seq  +upstreamnt  +downstreamnt
atgctggtctcctcttccgctttatgtgaagcacagagttcgcattctacgttcacattt
cataacaccctcatgccagagccgtcttcactgcaggcagggaagggctatttggtgctc
acacctcagtttgccgcgacgaccggcaaatttcacgatcctcgcctcgatcatgctatt
gagcgcgccatgtcgcaattgaaacaggaaactggcgtcctgattcctgtcgatgttcag
tcggcatccgaggtaagccatcctgtcttttcgattagtgtggatggccccggtgaaaaa
gtgcaatcggtcgatgagaacgaatcctattctctgactgtgacctcgcaaagcgtgcat
ctgcaggctgccactgatgtgggcgcgatgcatggtctgcagacgctgcttcaattggtg
cagcacacagacacgcaatattttcttcccgccgttaccattcacgattccccacgcttt
ccctggcgcggactaatgctggattgcagccgccacttcgaaccgattccggttatcaag
cgcacactcgacgccatggcggcggtaaagatgaatgtcttccactggcacttgagcgac
gaccagggcttccgtatccagagcaaagcctttcccctgctgacccaacgcggttctgac
ggggacttctatacccaggcgcaggctcgggaaatcgtggcttacgctcgggcgcgaggc
attcgtgtggttcccgagtttgatatgcccgggcataccagctcatggttcgtgggttat
ccgaatctcgcgagcgcttctggcccattccatatcgagcgccactttggagtctttgac
cccgtcatggacccgacacgcgcgagcacctatgtgttcctcgacaaattcatcgcagaa
atggcgagcatctttcctgacccgtacatgcacattggcggcgatgaaaataatggcgtg
gagtggaagcacaatcctcgtatccaggcattcatgcgtgcccacaatttgaagggcact
gccgccttgcaggcctacttcaatcggagactgctgaagattctgcagaagtatcacaag
cacatgattggctgggatgaggtgctcgctcctggactgcccacggatgtcatgattcag
tcctggcgtggttacgattcgctggcctctgccgcgcgcaagggatacaccggtattctc
tcctccggttactaccttgacagcatgcaaacggccgcggagcactatgccgttgatccc
atcccgtccagcagcacgctcacacctgaacagcgcaagcgcattctcggcggtgaggct
tgcatgtggggcgagtacgtcaattcgaacatcatcgactcgcgcgtatggccgatcaca
gccgcgatagcggagcgtctgtggtccgcgcagagcgtgaacaatgtgaatgacatgtac
cgccgcctcagggtggaatcattacggatagaggcgttgggtcttacacagatttcacag
gaagatgcaagcctgaggcaacttgccggcactcagaaaattacacaattaaaggtgctt
gctgccacgctcgaacctgcaaccttcgatcaacgggatcaatacaccctgcagcataat
gtcacacagcagacaccactcgatcatctggtggatgctctcagaccggatccgcccttc
cgtcatgactttgagcagctcgtccagagatatctggaccatccggatgcgaacagcaag
cagaatcagcggttgcgcatgctgatggagacctgggtcacccaacaagaccgggtatct
gagcagatgcgccattctccccgcctggcccccgcgcagattcgatcagtgcagttgggg
caaatgggtagcatgggattgcaggccatcggctatctgggaacaggcaagaccccgcct
ccgggctgggaagcagcccaagttgcgcttctcaagcaggcggcggaaccgatagacctg
acgcgctttgacatcatgaagccaatgcagatgctggtggaagcagcgtcaggaaagcat
gctgcagccgccgcacattga

DBGET integrated database retrieval system