KEGG   Acidobacterium capsulatum: ACP_0049Help
Entry
ACP_0049          CDS       T00868                                 

Definition
alpha-galactosidase (EC:3.2.1.22)
Orthology
K07407  
alpha-galactosidase [EC:3.2.1.22]
Organism
aca  Acidobacterium capsulatum
Pathway
Galactose metabolism
Glycerolipid metabolism
Sphingolipid metabolism
Brite
KEGG Orthology (KO) [BR:aca00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    ACP_0049
  Lipid metabolism
   00561 Glycerolipid metabolism
    ACP_0049
   00600 Sphingolipid metabolism
    ACP_0049
Enzymes [BR:aca01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.22  alpha-galactosidase
     ACP_0049
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
71812..73032
Genome map
AA seq 406 aa AA seqDB search
MKMKAVSQKALRCAVVLAVALVTAVALPAQNKPYPTAAQLAPTPPMGWNSWNHFAGKVDE
ADVRAAAKAMVDSGMAAAGYKYIVIDDTWQGKRDAQGFIHPNSKFPDMPGLIQYVHSLGL
KFGIYSSPGPQTCAGYEGSYGHVQQDAETYARWGVDYLKYDLCSYLGIMHKEAANNPAKA
LAMQQAAYLKMYKALAAAGRPIVFSLCQYGIGDVWKWGPSVGGNLWRTTGDIQDNYARMA
TIGFGQAGLAKYAGPGHWNDPDMLEVGNGGMTNEEYRTHMSLWALLAAPLIAGNDLSHMS
PATLAILTNREVIAVDQDRLGREGDRVSKNGALEIWAKPLTGGAKAVGLFNRDTQPHSMT
LQLSVVNFPPHAHLRDLWRHKTVHAHHGAYTVTVPAHGVVLLKLTR
NT seq 1221 nt NT seq  +upstreamnt  +downstreamnt
gtgaaaatgaaagcggtatcacagaaagccctgcgttgcgccgtggtgctcgccgtggcg
ctcgtcacggccgttgctctccctgcacagaacaagccctaccccaccgcggctcaactg
gctcccacgccgcccatgggctggaatagctggaatcacttcgcaggcaaggtggatgag
gccgatgtgcgcgccgctgccaaggccatggttgacagtggcatggccgccgccggatac
aaatacatcgtcatcgacgacacctggcagggcaagcgcgacgcgcagggattcattcat
cccaacagcaaattccctgacatgccgggcctgattcaatacgtccattcgcttggcctc
aagttcggcatctactcctcgcccgggccgcaaacctgcgcgggctatgagggcagctac
ggtcacgtccagcaggatgcagagacctacgcccgctggggtgtcgattatctcaagtac
gacctgtgcagctatctcggcatcatgcacaaagaggccgccaacaatcctgccaaggct
ctcgccatgcaacaggccgcctacctcaagatgtacaaggccctcgccgccgccggccgt
cccatcgtcttcagcctctgccagtacggcattggtgatgtgtggaagtggggccccagc
gtcggcggcaatctgtggcgcaccaccggcgacattcaggacaactacgcccgcatggcc
accattggcttcggccaggcgggactcgcaaaatacgccggccccggtcactggaatgac
cccgacatgctcgaagtcggcaacggcggcatgaccaatgaggagtatcgcacgcacatg
tcgctctgggccctcctcgccgcgccgctcatcgccggcaatgatctcagccacatgtcg
ccggctactctcgccatcctcaccaaccgcgaggtcatcgccgtcgatcaggaccgcctg
ggcagggaaggggatcgcgtctcaaagaatggcgcgctcgaaatctgggccaagcctctc
accggcggagccaaggccgtcggcctcttcaaccgcgacacgcagccgcactccatgacg
ctgcagctttcggtcgtcaacttcccgccgcacgcgcatctgcgcgacctgtggcggcac
aaaaccgtgcatgcccatcatggcgcttataccgtcacggttcccgctcacggagtggtg
ctgcttaagctcacgcgctga

DBGET integrated database retrieval system