KEGG   Acidobacterium capsulatum: ACP_0066Help
Entry
ACP_0066          CDS       T00868                                 

Gene name
agaN
Definition
alpha-galactosidase
Orthology
K07407  
alpha-galactosidase [EC:3.2.1.22]
Organism
aca  Acidobacterium capsulatum
Pathway
Galactose metabolism
Glycerolipid metabolism
Sphingolipid metabolism
Class
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:aca00052]
Metabolism; Lipid metabolism; Glycerolipid metabolism [PATH:aca00561]
Metabolism; Lipid metabolism; Sphingolipid metabolism [PATH:aca00600]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(88869..91046)
Genome map
AA seq 725 aa AA seqDB search
MAMAAHGASASNGPVHYDAQTHVFRIDAKGVSYVFGVNPNGQLQSIYWGSRLGFTDSFPQ
PHALPGWAAFDPSVNTTPQEFTGWGGGLYTTPDLKITFPDGNRDLVLHYVSHQIDGDRLT
VTMQDIERKVFVVLDYKIDEATGILRRSATIENRTGKPFTIEQSFAATWNLPAAGDYHLY
DLTGRWTGEWDLQQQALHPGKIVLESRRGPTSHANNPWFAIERGASADQDQGQVWFGALG
WSGNWQIAVEQTQARQVRVTGGFNPFDFGYVLAPGESLKTPYFYAGYTRNGVGGASRLLH
RFEIAEILPHHPHPGLRPVVYDSWEATGFQVNEAGQEALAEKAASIGVERFIMDDGWFGQ
RKDDHAGLGDWYPNPQKFPHGLGPLIAKVHSLGMSFGLWVEPEMVNPNSDLYRKHPDWVL
HFNGRPRSQERNQLVLNLARPDVKAYVFHTLDSLLTNNRIDFLKWDYNRNWSEPGWPSAG
ADHEKEVYVKYTRNLYSILQELRARHPHVEIEDCSGGGGRVDLGILRYTDEVWTSDNTDP
FDRLSIQNGFTYAYSPGVMMAWVTDSPNWVNQRVTSLTYRFLSSMQGALGIGANLNQWTP
QEFVQARTLVAQYKSIRATVQRGALYRLISPLHGSEHSATEYVAPDGKQVAVFAFLHSSQ
MGYPYPELYLRGLEPGATYRLHMLDGKAAPETPSNASGAYWTNVGIQLALRGDFQAAAFT
LEREP
NT seq 2178 nt NT seq  +upstreamnt  +downstreamnt
atggcgatggcggcccacggggcttccgccagcaatgggccggtccactatgacgcccaa
acccacgtctttcgtatcgacgcaaagggtgtgagctatgtctttggagtaaacccgaac
ggccagttgcagtcgatctactggggctcgcgcctgggcttcaccgattcttttccccag
ccgcacgcgttgccaggctgggccgcgttcgatccttcggtcaacaccactccgcaggag
ttcaccggctggggtgggggcctgtacaccacccccgatctgaaaatcaccttccccgac
ggcaatcgcgatctcgtgctccactacgtatcgcatcagatcgacggcgaccgcctcact
gtaaccatgcaggacatcgaacgaaaggtcttcgttgtactcgattacaagatcgatgaa
gccaccggcatcctgcggcgttcggcaaccatcgaaaaccgcacgggaaagcctttcacg
attgagcagtccttcgccgcgacctggaatcttcccgctgccggcgactaccatctctat
gacctgaccggccgctggaccggggagtgggacttgcagcagcaggcgctgcatccgggc
aagatcgtgctcgaaagccggcgaggccccaccagccacgccaataatccgtggttcgcc
attgagcgcggtgcctcagcggatcaggatcaggggcaggtgtggtttggcgcgctgggc
tggagcggaaactggcagatcgccgtcgagcagacgcaggcccggcaagtgcgcgtcacc
ggcggcttcaacccctttgattttggctacgttctggctcccggcgagtcgctcaaaacg
ccctacttctacgccggttatacgagaaacggtgtgggcggagcctcgcgcctgttgcat
cgctttgaaatcgccgaaattctgccccaccacccgcatcccgggctgcgtccggtcgtc
tatgactcctgggaggcaacgggatttcaggtgaatgaggccgggcaagaggcgctcgcg
gagaaggccgccagcatcggcgtcgagcgattcatcatggacgacggctggtttggccag
cggaaggatgaccatgccggtctcggcgactggtaccccaacccgcaaaaatttccgcac
ggccttgggccgctgatcgccaaggttcactccctgggcatgagctttggcctgtgggtc
gagcccgagatggtgaaccccaacagcgatctctaccgcaagcatccagactgggtgctc
cacttcaacggacgcccgcgttcccaggagcgcaaccagctcgtgctcaatcttgcacgg
cccgatgtaaaggcttacgtctttcacaccctcgattccctgctgaccaataaccgcatc
gactttctcaagtgggactacaaccggaactggtcagagccaggctggccctcggcgggc
gcggaccacgagaaggaagtctacgtaaagtacacgcgaaacctgtacagcattcttcag
gagctgcgcgcccgtcatccgcacgtggaaattgaggactgctcgggcggtggcggccgc
gtcgatctcggcattctgcgctacaccgatgaggtatggacctcggacaacaccgatccg
tttgaccggctctccattcagaacggcttcacctacgcctactcgcccggtgtcatgatg
gcctgggtgacggattcgcccaactgggtcaaccagcgggtcacttccctgacgtaccgc
tttctctcatcgatgcagggcgcgctcggtatcggggccaatctgaaccaatggacaccc
caggagttcgtccaggcgcgcacactggtcgcgcaatacaagtccattcgcgccacggtg
cagcgcggcgcgctctaccggctgatctcgccgctccacggcagcgaacactccgccacc
gagtatgtggcgccggatggcaagcaggtggcggtctttgccttcctgcattccagccag
atgggctacccctatcccgagctctacctgcgtggattagagccgggcgccacctatcgc
ctgcatatgctcgatggaaaagccgcgccagagacgccctcgaacgcgagcggcgcctac
tggacgaatgttggaattcagcttgcccttcggggcgactttcaggccgcagccttcacc
ctggagcgtgaaccctga

DBGET integrated database retrieval system