KEGG   Acidobacterium capsulatum: ACP_0076Help
Entry
ACP_0076          CDS       T00868                                 

Definition
endo-1,4-D-glucanase
Orthology
K01179  
endoglucanase [EC:3.2.1.4]
Organism
aca  Acidobacterium capsulatum
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:aca00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    ACP_0076
Enzymes [BR:aca01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.4  cellulase
     ACP_0076
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
109786..110952
Genome map
AA seq 388 aa AA seqDB search
MMRMRMKLLRHVLSVASLSALIFATGCRAQSWPLWQAYQGKFLNSDGRVVDYNAQARTTS
EGQSYALFFALVANDRPAFDKVLAWTQNNLAQGDLTAHLPAWEWGKAKDGQWKTIDPNPA
SDADLWISYTLLQAGRLWHDPHYTALGTVMAKRIANEEVANLPGLGSMLLPGPTGFHPNA
ATWLLNPSYMPLPVVEGMAHADPSGPWAGMAAAVPDLVKGASPAGFVMDWVSYSQAGGFQ
PAVLPTAPKGTVPMGSYDAIRVYLWTGMANPATPGAKLTLRALYGMAAYLKSHTLPPEKV
DPQGKVLSTSAPVGFSAAVEPFLSALGDKGDLNTQQARLDAMVNPNTKLYGEPPAYFDQN
LAMFGEGWQQHRFGFASDGDLWVKWKGR
NT seq 1167 nt NT seq  +upstreamnt  +downstreamnt
atgatgaggatgcgaatgaaattactcaggcatgtgctgtccgtcgcatccctgtcggcg
ctgatcttcgcgacgggatgccgcgcgcagtcctggccgctctggcaggcctatcaaggc
aagttcctcaactctgacgggcgcgtggtcgactacaacgcgcaggcgcgcacgacgtcg
gaagggcagtcctacgcgctcttctttgcgctggtggccaatgaccgccccgcctttgat
aaggtgctcgcctggacgcagaacaaccttgcgcagggcgacctgaccgcgcacctgccg
gcctgggaatggggcaaggcgaaggatggtcagtggaagaccattgatcccaatccggcc
agcgatgccgatttgtggatcagctatacgctgctccaggctggccgcctctggcacgat
ccgcattacacggcgcttggcactgtcatggcaaagcgcatcgcgaacgaggaagtcgcc
aatcttcccggactgggctccatgctgctgccgggaccgaccggatttcatcccaatgcg
gcgacctggctgctcaacccgagctacatgcctctgcccgtggtcgaaggcatggcgcac
gccgatcccagcggaccctgggctggcatggccgccgccgttcctgatctggtgaagggt
gcctcgcccgccggatttgtaatggattgggtgagctactcccaggcgggcggatttcag
ccggccgtgttgcccaccgctcccaaaggcacggtgcccatgggcagctatgacgccatt
cgtgtttatctctggaccggcatggcgaaccccgccacgcccggcgccaagctgactctg
cgggccctctatggcatggcggcttatctgaagtcacacacgctgccgcccgagaaggtg
gatccccagggcaaggtgctttccacctcggctccggtcggattttccgccgccgtcgag
ccttttttgtcggctcttggcgacaagggggacctgaatacacaacaggcacgtcttgac
gcgatggtgaacccgaacactaagctgtacggggagccgcctgcatattttgaccagaat
ctcgccatgtttggcgagggctggcagcagcatcgttttggctttgcgagcgatggagac
ctctgggtgaaatggaagggcagatga

DBGET integrated database retrieval system