KEGG   Acidobacterium capsulatum: ACP_0125Help
Entry
ACP_0125          CDS       T00868                                 

Gene name
pfkA1
Definition
Phosphofructokinase (EC:2.7.1.11)
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
aca  Acidobacterium capsulatum
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:aca00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    ACP_0125 (pfkA1)
   01230 Biosynthesis of amino acids
    ACP_0125 (pfkA1)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    ACP_0125 (pfkA1)
   00030 Pentose phosphate pathway
    ACP_0125 (pfkA1)
   00051 Fructose and mannose metabolism
    ACP_0125 (pfkA1)
   00052 Galactose metabolism
    ACP_0125 (pfkA1)
  Energy metabolism
   00680 Methane metabolism
    ACP_0125 (pfkA1)
Enzymes [BR:aca01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     ACP_0125 (pfkA1)
Protein phosphatases and associated proteins [BR:aca01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     ACP_0125 (pfkA1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
171366..172403
Genome map
AA seq 345 aa AA seqDB search
MRVGILTGGGDCPGLNAVIHAVVKKGIQHYGDEFVGFVEGWRGVLDNNTVALTLEKVDGI
LDQGGTILRTSRTNVRKIEGGIEKCVETLKANKLDALIAIGGDDTQSVTNALIQAGVPGV
GVPKTIDNDLNGTDACFGFDTAVSIATEAIDRLHTTAEAHNRVIVCEVMGRDAGWIALTA
GVAGGAHAVLVPEKQIDLDHVCKLLKYNHDHGKKYGIVVVAEGAKLPDSGAQATHGTKVD
SFGHARLSGIGSILADEIEKRTGYETRSVNLGHTQRGGTPTAYDRMLSTRYGLAAIDLVH
QGKFGRLVVLRGTKIEDIPLADAIAKNRTLDESFLSILDGLEPKV
NT seq 1038 nt NT seq  +upstreamnt  +downstreamnt
atgcgcgtcggaattttgacaggcggcggcgattgccccggactgaatgcagtgattcat
gcggttgtgaagaagggaattcagcactacggcgatgagttcgtcggctttgtggaaggc
tggcgcggcgtgctcgacaacaacaccgtggcgctgacgctggagaaggtggacggcatt
ctcgatcagggcggcaccattctgcgcacctcgcgcaccaacgtgcgcaagatcgagggc
ggcattgagaagtgcgtcgagaccctcaaggccaataagctcgatgcgctgatcgcgatt
ggcggcgatgatacgcagtcggtgaccaacgcgctgattcaggccggtgtaccgggcgtg
ggcgtgcccaagacgattgacaacgacttgaacggcaccgatgcctgcttcggctttgac
actgctgtgtcgattgccaccgaggccatcgaccgcctgcacaccaccgccgaggcgcac
aaccgcgtcatcgtgtgcgaagtgatgggccgcgatgcgggctggatcgcgctgacggcc
ggcgtagccggtggcgcgcatgccgtgctggtgcccgaaaagcagatcgacctcgatcac
gtctgcaagctgctcaagtacaaccatgaccacggcaagaagtacggcatcgtcgtggtg
gccgaaggcgccaagctgcccgactcgggcgcgcaggcgacgcacggcaccaaggtggac
tcctttggccatgcccgtttgagcggcatcggctctattctggccgacgaaatcgagaag
cgcaccggctatgagactcgctcggtgaacctgggtcacacgcagcgcggcggcacgccg
acggcctatgaccgcatgctctcgacgcgctatggcctggcggccatcgatctggtccac
cagggcaagttcggacgcctggtggtgctgcgcggcacgaagatcgaggatattccgttg
gccgacgcgattgccaagaatcgcactctcgatgagagcttcctctcgattctggatggt
ctggaaccgaaggtttag

DBGET integrated database retrieval system