KEGG   Acidobacterium capsulatum: ACP_0144Help
Entry
ACP_0144          CDS       T00868                                 

Gene name
xynZ
Definition
endo-1,4-beta-xylanase (EC:3.2.1.8)
Orthology
K01181  
endo-1,4-beta-xylanase [EC:3.2.1.8]
Organism
aca  Acidobacterium capsulatum
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
185352..186485
Genome map
AA seq 377 aa AA seqDB search
MAPHLHEVSGPRSLRAHAAAAGLLVGCAVNPRGLDGEPAYSQTVADQMNLLVAENAMKWG
PLRPTIDTFDFRPADDIMDFAARHNQQVRGHNLCWHEELPTWFASEVNKGNAKEILIQHI
QTVAGRYAGRIQSWDVVNEAILPKDGRPDGLRKSPWLELLGPDYIDIAFHTARLADPHAL
LTYNDYGIEKDTPEDTIKRGDVLMLIRRMKARGVPLDAVGIQSHLTAGDPMPGAGLRAFV
RECGRLGLQVFVTEMDVNDKKLPAAVEERDQAVAKVYQDYLTMMLAEPNVTAVLTWGVTD
KYTWLDGPKFGRADGRPERPLPFDSDYQPTPAFFAERAALDSRAARLSAPVRQGDPYAPF
RPGSARGGAAGPQSERQ
NT seq 1134 nt NT seq  +upstreamnt  +downstreamnt
atggctccgcatctgcatgaggtgagcgggccgcgctcgctgcgtgcgcatgcggcggcg
gcaggcttgctggtgggctgcgcggtcaatcctcgcggcctggacggagagccggcctat
agccagacggtcgccgatcagatgaatctgctggtggccgaaaatgcgatgaagtgggga
ccgctgcggcccacgatcgatacctttgactttcgcccggcggacgacatcatggatttt
gccgcgcgccacaatcagcaggtgcgcgggcataatctctgctggcatgaggagttgccc
acctggtttgcctctgaggtgaacaagggcaatgcaaaggagattctgattcagcacatt
caaacggtggcgggccgctatgccgggcgcattcagtcgtgggatgtggtgaatgaggcg
atcctcccgaaggacggacggccggatggtctgcgcaagtcgccgtggctggaactgctg
ggcccggattacatcgatattgcgttccacacggcgcgcctggccgatccgcacgcgctg
ctgacctataacgactacggcattgagaaagacacgcccgaggacacgatcaagcgcggc
gatgtgctgatgctgattcggcgcatgaaggcgcggggcgtgccgctggatgcggtgggg
attcagagccatctgacggcgggcgacccgatgccgggcgcggggctgcgggcctttgtg
cgggagtgcggccgcctgggcctgcaggtatttgtcaccgagatggatgtgaatgacaaa
aagctgccggcggcggtggaagaacgcgatcaggcggtggcgaaggtctatcaggactac
ctgacgatgatgctggccgagcccaatgtgaccgccgtgctgacgtggggcgtcacggac
aaatacacctggctggacgggccaaagttcgggcgcgccgatggacggccggagcgtccg
ttgccgtttgactctgactatcagcctaccccggccttttttgcagagcgcgcggcgctg
gactcgcgggcggcacggctgtcggctccggtgcggcagggcgatccttatgcgcctttc
cggcctggttcggcgcggggcggggcggctgggccacaatcggagcggcagtag

DBGET integrated database retrieval system