KEGG   Acidobacterium capsulatum: ACP_0228Help
Entry
ACP_0228          CDS       T00868                                 

Gene name
thrC1
Definition
(GenBank) threonine synthase
  KO
K01733  threonine synthase [EC:4.2.3.1]
Organism
aca  Acidobacterium capsulatum
Pathway
aca00260  Glycine, serine and threonine metabolism
aca00750  Vitamin B6 metabolism
aca01100  Metabolic pathways
aca01110  Biosynthesis of secondary metabolites
aca01120  Microbial metabolism in diverse environments
aca01230  Biosynthesis of amino acids
Module
aca_M00018  Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:aca00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    ACP_0228 (thrC1)
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    ACP_0228 (thrC1)
Enzymes [BR:aca01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     ACP_0228 (thrC1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP
Motif
Other DBs
NCBI-ProteinID: ACO34584
UniProt: C1F975
Position
281225..282589
Genome map
AA seq 454 aa AA seqDB search
MRAAHQLRCTGCGQVTPPEEIAGDFRCAACGELFAVEYPGWAGAAPPNPGALRWLWKERR
SSLAAADQSGVWRFRELLPIVQEHEIVTLREGNTPLYHLTQNAERLALPELYAKHQGMNP
TASFKDTGMTAALSVAKARGFRWVACASTGNTSAAMAAYAARAGMRSLVLVPDGKIAWSK
LAQSMDYGALTLQLKTDFDGCVAVLREVVRRAPVYLLNSVNPYRVEGQKTPAMEIVEALD
WQAPEHVIVPGGNLANISALGKGFAEMHALGLLPVLPKLSVIQAEGANPLVRTMHEFSGE
KLEPVEAQTRATAIRIGNPASWKKAVAVLRATGGTVEQVSEAEIALAKARLGAEGIGCEP
ASAVTLAGLEKMLIAGKVQRGERVVLLLTGHTLKDADYTIAYHRGELLRADEVAGPEQAA
LAQAIRDSRRDAVACEANVDAVLRLLHARDGGTA
NT seq 1365 nt NT seq  +upstreamnt  +downstreamnt
atgcgtgcagcccaccaactgcgttgcacaggatgcgggcaggtaacgccgccggaagag
attgcgggcgactttcgttgcgctgcctgcggagagctgttcgccgtggagtatccgggc
tgggctggagcagcgccgccgaatcccggcgcactgcgctggctgtggaaggaacggcgc
agctcactcgccgccgccgaccagagcggcgtctggcgctttcgcgagctgctgccgatt
gttcaggagcacgagattgtcacgctgcgcgagggcaatacgcctctctaccatctgacg
cagaatgccgaacggcttgcgctgccggaactctatgccaagcatcagggcatgaatcca
accgcgtcgttcaaagacacgggcatgacggcggctctgagcgtggccaaggcgcgcggc
tttcgctgggtggcctgcgcctccaccggcaacacttcggcggcgatggcggcttacgcg
gcgcgcgcgggcatgcgcagcctggtgctggtgcccgatggcaagatcgcatggagcaag
ttggcgcagtcgatggattacggcgcgctgacgctccaactgaaaaccgattttgacgga
tgtgtcgcggtgctgcgtgaggtggtgcggcgcgctccggtgtatctgctgaattcggtc
aatccttaccgcgtggaagggcagaagacgccggcgatggaaatcgtggaggctctggac
tggcaggcgccggagcatgtgattgtgccgggcggcaacctggcgaatatctcggcgctg
ggcaagggctttgcagagatgcatgcgctggggctgctgcccgtgctgccgaagctgtcc
gtgattcaggccgagggcgcgaatccgctggtgcgcaccatgcatgagttctctggagaa
aagctggagccggtggaggcgcaaacgcgcgccacggcgatccggataggaaaccccgcc
tcatggaaaaaggcggtagctgtgctgcgggccacgggcggtacggtggagcaggtttcg
gaagccgaaattgctctggccaaggcgcggctgggcgcggaaggcatcggctgcgagccg
gcttccgcggtgacgctggcgggccttgaaaagatgctcatcgcgggcaaggtgcagcgg
ggcgaacgcgtcgtgctgctgctgaccgggcacacgctcaaggatgccgattacacgatt
gcttatcatcgcggcgaactgctgcgcgctgacgaagtagccgggccagagcaggctgcg
ctggcgcaggccattcgagactcgcgccgggatgctgtggcctgcgaggccaatgtggac
gcggtgctgcggctgctgcatgcgcgcgacggagggacggcatga

DBGET integrated database retrieval system