KEGG   Acidobacterium capsulatum: ACP_0228Help
Entry
ACP_0228          CDS       T00868                                 

Gene name
thrC1
Definition
(RefSeq) threonine synthase (EC:4.2.3.1)
  KO
K01733  
threonine synthase [EC:4.2.3.1]
Organism
aca  Acidobacterium capsulatum
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:aca00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    ACP_0228 (thrC1)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    ACP_0228 (thrC1)
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    ACP_0228 (thrC1)
Enzymes [BR:aca01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     ACP_0228 (thrC1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
281225..282589
Genome map
AA seq 454 aa AA seqDB search
MRAAHQLRCTGCGQVTPPEEIAGDFRCAACGELFAVEYPGWAGAAPPNPGALRWLWKERR
SSLAAADQSGVWRFRELLPIVQEHEIVTLREGNTPLYHLTQNAERLALPELYAKHQGMNP
TASFKDTGMTAALSVAKARGFRWVACASTGNTSAAMAAYAARAGMRSLVLVPDGKIAWSK
LAQSMDYGALTLQLKTDFDGCVAVLREVVRRAPVYLLNSVNPYRVEGQKTPAMEIVEALD
WQAPEHVIVPGGNLANISALGKGFAEMHALGLLPVLPKLSVIQAEGANPLVRTMHEFSGE
KLEPVEAQTRATAIRIGNPASWKKAVAVLRATGGTVEQVSEAEIALAKARLGAEGIGCEP
ASAVTLAGLEKMLIAGKVQRGERVVLLLTGHTLKDADYTIAYHRGELLRADEVAGPEQAA
LAQAIRDSRRDAVACEANVDAVLRLLHARDGGTA
NT seq 1365 nt NT seq  +upstreamnt  +downstreamnt
atgcgtgcagcccaccaactgcgttgcacaggatgcgggcaggtaacgccgccggaagag
attgcgggcgactttcgttgcgctgcctgcggagagctgttcgccgtggagtatccgggc
tgggctggagcagcgccgccgaatcccggcgcactgcgctggctgtggaaggaacggcgc
agctcactcgccgccgccgaccagagcggcgtctggcgctttcgcgagctgctgccgatt
gttcaggagcacgagattgtcacgctgcgcgagggcaatacgcctctctaccatctgacg
cagaatgccgaacggcttgcgctgccggaactctatgccaagcatcagggcatgaatcca
accgcgtcgttcaaagacacgggcatgacggcggctctgagcgtggccaaggcgcgcggc
tttcgctgggtggcctgcgcctccaccggcaacacttcggcggcgatggcggcttacgcg
gcgcgcgcgggcatgcgcagcctggtgctggtgcccgatggcaagatcgcatggagcaag
ttggcgcagtcgatggattacggcgcgctgacgctccaactgaaaaccgattttgacgga
tgtgtcgcggtgctgcgtgaggtggtgcggcgcgctccggtgtatctgctgaattcggtc
aatccttaccgcgtggaagggcagaagacgccggcgatggaaatcgtggaggctctggac
tggcaggcgccggagcatgtgattgtgccgggcggcaacctggcgaatatctcggcgctg
ggcaagggctttgcagagatgcatgcgctggggctgctgcccgtgctgccgaagctgtcc
gtgattcaggccgagggcgcgaatccgctggtgcgcaccatgcatgagttctctggagaa
aagctggagccggtggaggcgcaaacgcgcgccacggcgatccggataggaaaccccgcc
tcatggaaaaaggcggtagctgtgctgcgggccacgggcggtacggtggagcaggtttcg
gaagccgaaattgctctggccaaggcgcggctgggcgcggaaggcatcggctgcgagccg
gcttccgcggtgacgctggcgggccttgaaaagatgctcatcgcgggcaaggtgcagcgg
ggcgaacgcgtcgtgctgctgctgaccgggcacacgctcaaggatgccgattacacgatt
gcttatcatcgcggcgaactgctgcgcgctgacgaagtagccgggccagagcaggctgcg
ctggcgcaggccattcgagactcgcgccgggatgctgtggcctgcgaggccaatgtggac
gcggtgctgcggctgctgcatgcgcgcgacggagggacggcatga

DBGET integrated database retrieval system