KEGG   Acidobacterium capsulatum: ACP_0552Help
Entry
ACP_0552          CDS       T00868                                 

Definition
glycosyl hydrolase
Orthology
K01190  
beta-galactosidase [EC:3.2.1.23]
Organism
aca  Acidobacterium capsulatum
Pathway
Galactose metabolism
Other glycan degradation
Sphingolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:aca00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    ACP_0552
  Lipid metabolism
   00600 Sphingolipid metabolism
    ACP_0552
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    ACP_0552
Enzymes [BR:aca01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.23  beta-galactosidase
     ACP_0552
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
624914..626908
Genome map
AA seq 664 aa AA seqDB search
MLALFLLPVSVMAAARRGNSSALSDQRGSFRVENGKFVLDGQPFQIISGEMHYERIPRAY
WKARLQMAKAMGLNTIATYVFWNLHEPEPGKFDFSGNADLAQFIRDAQQTGLKVLLRAGP
YSCAEWEFGGFPAWLMKNPKMQTALRSNDPEFMKPAEQWILRLGREVAPLQVGYGGPIIG
VQIENEYGDFGGDAAYLEHLKKIFLKAGFTQSLLYTANPSRALVRGSIPGVYSAVNFAPG
HAAQALDSLAQLRAGQPLLSSEYWTGWFDHWGEPHQSKPLSLQVKDFNYILRHGAGVNLY
MFHGGTSFGMMSGSSWTKHQFLPDVTSYDYGAPLDEAGHPTPAYYAYRKIIAAYLGHALP
PVPAAPPVMAIAPFALHEASSLWRGLPKPVVTKNPEPMEWLGQSYGFILYRKTLHHAVDG
DLVLNGMNDYALVYLNGKLQGTLNRTCNDSTLMLHSNSAKTRLDILVENSGRINSTRMML
HANKGLMGPVMLAGRALHGWKTYRLPMKPDTIADPLGMPQETHFNEKSTPAQAMSGPAFY
RGTFRVETKSKQIPDTFLDIRGLGKGAVWIDGHPIGRYWNVGPQDTLYVPGPWLHRGKNE
IMVLDLFQRTNLPRLAGLTQPILNGPARKVCNATELSSAPAEMHGRGKGRAAQPGVSRAK
ETKH
NT seq 1995 nt NT seq  +upstreamnt  +downstreamnt
atgctcgcgttgtttctgctgccggtgagcgtgatggccgcggcccggaggggtaatagc
tctgccctctctgatcagcgaggtagttttcgtgtagaaaacggcaaattcgtgctggac
ggccagccatttcaaatcatctcgggcgagatgcactacgagcggattccgcgggcctac
tggaaggctcgccttcagatggccaaggcgatgggcttgaacaccatcgccacctacgtc
ttctggaaccttcatgaaccggagccaggcaaattcgacttcagcggcaacgcagacctg
gcgcagttcatccgcgatgcacagcagacgggcctgaaggtgctgctgcgcgccgggcca
tactcctgcgcggaatgggaattcggcggatttcccgcctggctcatgaagaacccgaag
atgcaaaccgcgctgcgctcgaacgatccggaattcatgaagcctgcggaacagtggatc
ctccggctgggacgtgaagtggctccgctgcaggttggctatggcgggcccatcattggc
gtgcagatcgagaatgaatacggcgacttcggcggcgatgcagcctatctggagcacctg
aaaaaaatcttcctgaaggccggcttcacacaatcgctcctctacaccgccaatccatca
cgcgcgctggtgcgagggtcgattcccggggtgtactcggcggtcaactttgcccccggc
cacgcggcgcaggcgctggactcgctcgcacaactgcgcgccggccagccgctgttgtcc
tcagagtactggaccggatggttcgatcactggggcgaaccgcaccagagcaaacccctg
tcactgcaggtgaaggacttcaactacattctgcgccacggcgcgggcgtcaacctgtat
atgtttcatggtggaacgagcttcggcatgatgagcggttcgagttggaccaaacatcag
ttcctgccggacgtgacaagctacgattacggtgcgccactcgatgaagccggacatccc
accccggcgtactacgcctatcgaaaaatcattgccgcttacctgggccatgcactgccg
ccggttccggcggcgcctccggtgatggccattgcgccttttgcgctccatgaggcgtcc
tctttgtggcgggggttgcccaagcccgtcgttacgaaaaatcccgagcccatggagtgg
ctggggcaatcctacggattcatcctctaccgcaagaccctgcaccacgccgtcgatggc
gacctcgtactgaacggaatgaacgattacgcgctggtctatctgaacggtaagctgcaa
ggcacgctcaaccggacctgcaatgattcgacgttgatgctgcacagcaactccgccaag
actcgcctcgacatcctggtcgagaactccggacgcatcaactcgacgcgcatgatgctc
catgcgaataaaggcctgatgggccccgtgatgctcgcgggcagggcactgcatggatgg
aaaacataccggctgccgatgaagcccgataccattgccgatccactgggcatgccgcaa
gagacgcacttcaacgaaaagagcacgcccgcgcaggcgatgagcggcccggcgttctat
cgcggcacgtttcgcgtagaaacgaagtctaagcagatccccgatacttttctcgacatt
cgcggcctcggcaaaggcgcggtgtggatcgacgggcaccccatcggccgctactggaat
gttggcccgcaggacacgctgtatgtgccgggcccctggctgcaccgaggcaagaatgaa
atcatggtgctcgatctcttccaaagaaccaatctgccccggctggcggggctcacccaa
ccgattctgaatggccccgcgcgcaaagtttgcaacgcaacggaactatcctctgccccg
gcagaaatgcatggacgagggaagggacgcgcggcacaaccaggcgtgagccgcgccaag
gagacgaagcattga

DBGET integrated database retrieval system