KEGG   Acidobacterium capsulatum: ACP_0634Help
Entry
ACP_0634          CDS       T00868                                 

Gene name
tpiA
Definition
(GenBank) triose-phosphate isomerase
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
aca  Acidobacterium capsulatum
Pathway
aca00010  Glycolysis / Gluconeogenesis
aca00051  Fructose and mannose metabolism
aca00562  Inositol phosphate metabolism
aca01100  Metabolic pathways
aca01110  Biosynthesis of secondary metabolites
aca01120  Microbial metabolism in diverse environments
aca01130  Biosynthesis of antibiotics
aca01200  Carbon metabolism
aca01230  Biosynthesis of amino acids
Module
aca_M00002  Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:aca00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    ACP_0634 (tpiA)
   00051 Fructose and mannose metabolism
    ACP_0634 (tpiA)
   00562 Inositol phosphate metabolism
    ACP_0634 (tpiA)
Enzymes [BR:aca01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     ACP_0634 (tpiA)
Exosome [BR:aca04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   ACP_0634 (tpiA)
  Exosomal proteins of bladder cancer cells
   ACP_0634 (tpiA)
  Exosomal proteins of melanoma cells
   ACP_0634 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TIM
Motif
Other DBs
NCBI-ProteinID: ACO32249
UniProt: C1F1N2
Position
721488..722237
Genome map
AA seq 249 aa AA seqDB search
MRKPVIAANWKMYKTPAQAQEFVTAFLPLVAGQDRAEIVLCPSATSLATVVAAVGGSGIA
VGGQNIHQAEEGAYTGETSAQMLTALKVSHVIIGHSERRQYFCETDEIVNQKVHTALKHG
LTPILCIGELLEEREAGKTEEVLLKQASIALKGISAEQAKQIVVAYEPVWAIGTGKTATP
EMAGEAHFMIRTEIARLQGREVADAIRILYGGSVKPDNAASLLNQPEIDGALVGGASLVA
ESFAKIVKF
NT seq 750 nt NT seq  +upstreamnt  +downstreamnt
atgcgtaaacctgtcatcgctgccaattggaagatgtacaagactcctgcccaggcgcag
gagttcgtcaccgcgtttctgcccctcgttgctggccaggatcgcgccgaaatcgtgctg
tgcccctcggccacttcgctggccacggtggtggcggcggtcggcggctccggaattgcc
gtgggcggccagaacattcaccaggccgaagaaggcgcctacaccggcgagacctcggcg
cagatgctgacggcgctgaaggtttcgcacgtcatcattggccactcggaacgccggcag
tacttctgcgagaccgacgagatcgtgaatcagaaggtacacaccgcgctgaagcatggg
ctgacgccgattctgtgcatcggtgagttgctggaagagcgtgaagccggcaagaccgaa
gaagtgctgctgaagcaggcgtcgattgcactgaagggcatctctgccgagcaggcgaag
cagatcgttgtcgcctatgagccggtatgggcgattggcaccggcaagacggctacgccg
gagatggccggtgaagcacactttatgattcgcaccgaaattgcccgcctgcagggacgc
gaagtggccgatgccatccgcattctgtatggcggcagcgtgaagccggacaatgcggct
tccctgctcaaccagccggagattgatggcgcgctggtgggcggagcgagcctggtggcg
gagtcatttgcgaagattgtgaagttttag

DBGET integrated database retrieval system