KEGG   Acidobacterium capsulatum: ACP_0683Help
Entry
ACP_0683          CDS       T00868                                 

Definition
ROK family protein
Orthology
K00886  
polyphosphate glucokinase [EC:2.7.1.63]
Organism
aca  Acidobacterium capsulatum
Pathway
Glycolysis / Gluconeogenesis
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:aca00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    ACP_0683
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    ACP_0683
   00520 Amino sugar and nucleotide sugar metabolism
    ACP_0683
Enzymes [BR:aca01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.63  polyphosphate---glucose phosphotransferase
     ACP_0683
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
772108..772833
Genome map
AA seq 241 aa AA seqDB search
MAKKKSVSSKPVTLAVDIGGSHIKIMLLDYRGKPLSDRLRQPTPVPPTPENVLALLDGMR
AQVGDFDRVSIGFPGVVKEGITYTAANLDPAWIGFPFAHEIMKRWRRPVQLANDAAVQGF
GAIRGRGVELVLTLGTGLGSALYVNGHLCPGLELGHHPWRKGHSYEDYLGREGYDKHGKK
KWNKHLAKAIEQTLHTFNWDHLYLGGGNAKKITLDPQPNITIVSNEDGLTGGVALWRDVS
I
NT seq 726 nt NT seq  +upstreamnt  +downstreamnt
atggcaaagaagaaatctgtctcgagcaagccggttacgctggccgtcgatattggcggc
tctcacatcaagatcatgctgctggactaccgcggcaagcctttgagcgaccgcctgcgg
cagccgacgcctgttccgccaaccccggagaatgtgctggcgctgctggacgggatgcgc
gcgcaggtgggggattttgaccgcgtgagcatcggatttccgggcgtggttaaagaaggc
attacttacacggcggcaaacctggacccggcatggatcggcttcccttttgcgcacgag
atcatgaagcgctggcggcggcccgtgcagttggctaacgatgccgcggtgcagggcttt
ggcgcgattcgcggccgtggcgtggagctggtgctgacgctgggcacaggactcggctcg
gccctgtatgtgaacgggcatctgtgcccggggctggagctggggcatcatccctggcgc
aagggccacagctatgaggactacctgggccgcgaggggtatgacaagcacggcaagaaa
aagtggaacaagcacctcgcgaaggcgattgagcagacgctgcacaccttcaactgggac
catttgtatcttggcggcgggaatgcgaagaagattacgcttgatccgcagccgaacatc
accattgtgagcaatgaagacgggctgaccggcggcgtggctctgtggcgggatgtgtcg
atttaa

DBGET integrated database retrieval system