KEGG   Acidobacterium capsulatum: ACP_0683Help
Entry
ACP_0683          CDS       T00868                                 

Definition
(GenBank) ROK family protein
  KO
K00886  polyphosphate glucokinase [EC:2.7.1.63]
Organism
aca  Acidobacterium capsulatum
Pathway
aca00010  Glycolysis / Gluconeogenesis
aca00520  Amino sugar and nucleotide sugar metabolism
aca01100  Metabolic pathways
aca01110  Biosynthesis of secondary metabolites
aca01120  Microbial metabolism in diverse environments
aca01130  Biosynthesis of antibiotics
aca01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:aca00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    ACP_0683
   00520 Amino sugar and nucleotide sugar metabolism
    ACP_0683
Enzymes [BR:aca01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.63  polyphosphate---glucose phosphotransferase
     ACP_0683
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ROK
Motif
Other DBs
NCBI-ProteinID: ACO34600
UniProt: C1F1S4
Position
772108..772833
Genome map
AA seq 241 aa AA seqDB search
MAKKKSVSSKPVTLAVDIGGSHIKIMLLDYRGKPLSDRLRQPTPVPPTPENVLALLDGMR
AQVGDFDRVSIGFPGVVKEGITYTAANLDPAWIGFPFAHEIMKRWRRPVQLANDAAVQGF
GAIRGRGVELVLTLGTGLGSALYVNGHLCPGLELGHHPWRKGHSYEDYLGREGYDKHGKK
KWNKHLAKAIEQTLHTFNWDHLYLGGGNAKKITLDPQPNITIVSNEDGLTGGVALWRDVS
I
NT seq 726 nt NT seq  +upstreamnt  +downstreamnt
atggcaaagaagaaatctgtctcgagcaagccggttacgctggccgtcgatattggcggc
tctcacatcaagatcatgctgctggactaccgcggcaagcctttgagcgaccgcctgcgg
cagccgacgcctgttccgccaaccccggagaatgtgctggcgctgctggacgggatgcgc
gcgcaggtgggggattttgaccgcgtgagcatcggatttccgggcgtggttaaagaaggc
attacttacacggcggcaaacctggacccggcatggatcggcttcccttttgcgcacgag
atcatgaagcgctggcggcggcccgtgcagttggctaacgatgccgcggtgcagggcttt
ggcgcgattcgcggccgtggcgtggagctggtgctgacgctgggcacaggactcggctcg
gccctgtatgtgaacgggcatctgtgcccggggctggagctggggcatcatccctggcgc
aagggccacagctatgaggactacctgggccgcgaggggtatgacaagcacggcaagaaa
aagtggaacaagcacctcgcgaaggcgattgagcagacgctgcacaccttcaactgggac
catttgtatcttggcggcgggaatgcgaagaagattacgcttgatccgcagccgaacatc
accattgtgagcaatgaagacgggctgaccggcggcgtggctctgtggcgggatgtgtcg
atttaa

DBGET integrated database retrieval system