KEGG   Acidobacterium capsulatum: ACP_0717Help
Entry
ACP_0717          CDS       T00868                                 

Definition
glycosyl transferase family protein
Orthology
K01207  
beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
aca  Acidobacterium capsulatum
Pathway
beta-Lactam resistance
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:aca00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    ACP_0717
 Human Diseases
  Drug resistance
   00312 beta-Lactam resistance
    ACP_0717
Enzymes [BR:aca01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     ACP_0717
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
816439..817524
Genome map
AA seq 361 aa AA seqDB search
MPTKLNEVREAAGRVMMVGLSGTALSELERAWLKLIRPTGIILFRRNIETIPQTVALLRE
ASRIIDRPTLRCVDMEGGMVDRLRDVLTPMPSPARVFATRDPQMFYRHGKLIGKAAHMAG
FNATLAPVVDLALPNSAGVMKTRVVSALPHEVRQYALTFLEGLETEEVFGCAKHFPGLGG
GIVDSHLTMPVIDRKWADLWNEDLAPFRSLARRVPITMVAHAAYPLVTRNHTPASLSPHW
IQKILRKRVGFRGLVLSDDMEMGGVLSHCSMGEAVIHAIAAGTDVVEICHNPALILTAYE
ALIREAEQRVAFRRQLTAAARRVEEWARRWSLIQTQTLRSPTVAQIDKLRAQMAAFAREC
T
NT seq 1086 nt NT seq  +upstreamnt  +downstreamnt
atgcccacaaagctgaatgaagtgcgcgaagccgccggacgcgtgatgatggtggggttg
agcggcacggcgctgagcgagttggagcgggcgtggctcaagctgattcgcccgacgggc
atcattcttttccggcggaacattgagacgattccgcaaacggtagcactgctgcgcgag
gcaagccgcatcattgatcggcccacgctgcgttgcgtggacatggaaggcggcatggtg
gaccggctgcgcgacgtgctcacaccgatgccctcacctgcgcgggtgtttgccacgcgc
gacccgcagatgttttaccggcacggcaagctgattggcaaagccgcgcacatggccggc
ttcaacgcgacgctggcaccggtggtcgatctcgcgctgccaaactccgccggggtgatg
aagacgcgcgtggtatcggcgcttccgcatgaggtgcggcaatatgcgctgacgtttctt
gagggactggagacggaagaagtcttcggatgcgcaaagcattttccgggtttgggcggc
ggcattgtggattcgcacctgacgatgccagtgattgatcgcaagtgggccgatctgtgg
aacgaagacctggcgccctttcgctcgctggcgcggcgcgtgcccatcacgatggtggcg
cacgcggcctatccgctggtgacgcgcaatcacactccggcatcgctctcgccgcattgg
attcagaagattctgcgcaagcgcgtcggctttcgcggactggtactctctgacgatatg
gagatgggcggcgtgctctcgcactgctcgatgggtgaagcggtcattcatgccatcgcg
gccggcaccgatgtggtggagatctgccacaatccggcattgattttgacggcctacgaa
gcattgatacgcgaggcagagcagcgcgtcgcattccggcggcaactgacagccgcggcc
cgtcgcgtggaggaatgggcgcggcgatggagcctcattcaaacccagactctgcggagc
cccaccgtggcgcagatcgacaagttgcgcgcgcagatggcggcctttgccagggaatgt
acatga

DBGET integrated database retrieval system