KEGG   Acidobacterium capsulatum: ACP_0788Help
Entry
ACP_0788          CDS       T00868                                 

Gene name
glcK
Definition
(GenBank) glucokinase
  KO
K00845  glucokinase [EC:2.7.1.2]
Organism
aca  Acidobacterium capsulatum
Pathway
aca00010  Glycolysis / Gluconeogenesis
aca00052  Galactose metabolism
aca00500  Starch and sucrose metabolism
aca00520  Amino sugar and nucleotide sugar metabolism
aca00521  Streptomycin biosynthesis
aca01100  Metabolic pathways
aca01110  Biosynthesis of secondary metabolites
aca01120  Microbial metabolism in diverse environments
aca01130  Biosynthesis of antibiotics
aca01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:aca00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    ACP_0788 (glcK)
   00052 Galactose metabolism
    ACP_0788 (glcK)
   00500 Starch and sucrose metabolism
    ACP_0788 (glcK)
   00520 Amino sugar and nucleotide sugar metabolism
    ACP_0788 (glcK)
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    ACP_0788 (glcK)
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    ACP_0788 (glcK)
Enzymes [BR:aca01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     ACP_0788 (glcK)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ROK
Motif
Other DBs
NCBI-ProteinID: ACO32528
UniProt: C1F2C5
Position
complement(909943..910947)
Genome map
AA seq 334 aa AA seqDB search
MEVFSIGVDLGGSNLRVGAFTVRGERLKLIAFPTNAASGPAAVIDSMCEAIRVVHEELVA
THEFAGVGVGSPGPLSLPDGVLHQPPNLPGWDGVELRREITERLPWPVWVNSDANMAALA
ECRLGAGAEYGVDSLCMITLGTGVGGGIVLDGHLWHGLNGAAGEVGHGPLILNGPPCACG
ARGCLEVYASATAVVRRARELNLVAATEAHSDEAGTQLNAAKLAQMAEAGDAVARSIYEQ
AGHALGLGLANLVNTLNLPLYTIGGGVSAAWNLFAPRMFATLEEFSYVYRMSQPRDPNQY
EAGKTHICRARLGSDAGLLGAAMLPLVPRPLPRA
NT seq 1005 nt NT seq  +upstreamnt  +downstreamnt
atggaagtgttttcaatcggtgtggacctgggcggatcgaatctgcgtgtgggagcgttc
accgtgcgcggcgagcggcttaaactcatcgcgtttcctaccaatgcggcctctggcccc
gccgcggtcattgactccatgtgcgaggccattcgcgtggtgcatgaggaactggtcgca
acacacgaatttgccggtgtcggcgtcggcagtcccggaccactctctttacccgacggc
gttttgcaccagccgcccaacttgcccggctgggacggcgtggaactgcgccgcgagatc
accgagcgcctgccctggccggtatgggtcaactccgacgcgaacatggccgcgctggcc
gagtgccgcctgggcgcgggcgccgagtatggcgtggactccctctgcatgatcacgctc
ggcactggagtgggcggcggcattgtgctcgatggccatctctggcatgggctcaacggc
gcggcgggcgaagtcggccatggtccgctgattctgaacggcccgccctgtgcctgcggg
gcgcgcggatgcctcgaagtctatgcctcggcgaccgctgttgtgcgccgcgcgcgcgag
ctgaatctggtcgcggccactgaggcgcattctgatgaagcgggcacgcaactgaacgcc
gccaaactcgctcagatggccgaggccggcgatgccgtggcccgcagcatctatgagcag
gccggtcacgcgctcgggctgggcctggccaatctggtcaacacgctcaacctgcccctc
tacacgattggcggcggcgtctcggccgcgtggaatctctttgcgccccgcatgtttgcc
acgcttgaggagttcagctacgtctaccgcatgtcgcagcctcgcgaccccaaccaatat
gaagcgggcaaaacgcacatctgccgcgcgcgtctcggctcggatgcaggcctgctcggc
gcggccatgctgccgcttgtgccgcggcctctgccgcgcgcttga

DBGET integrated database retrieval system