KEGG   Acidobacterium capsulatum: ACP_0896Help
Entry
ACP_0896          CDS       T00868                                 

Definition
Acyl-CoA thioesterase I
Orthology
K10804  
acyl-CoA thioesterase I [EC:3.1.2.- 3.1.1.5]
Organism
aca  Acidobacterium capsulatum
Pathway
Biosynthesis of unsaturated fatty acids
Class
Metabolism; Lipid metabolism; Biosynthesis of unsaturated fatty acids [PATH:aca01040]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1047883..1048518
Genome map
AA seq 211 aa AA seqDB search
MNRRRLRFWLLLVCFAISLSSIARAAAHEPLVVCFGDSITAGHGLDPSQAYPVFLQHDLA
SRGYHYRVINAGVSGNTTKDALDRLPRVLGLHPAAVIVEFGGNDGLRGFPLNVTERNLGT
LVGRLRAAHIPVLLAGITLPPNYGQDYIHQFDEMYRRVAQKYHVPLLPMLYAGIYNLPGT
IQPDGIHPTAKGSRLIAQHLLPLLLPLLHRK
NT seq 636 nt NT seq  +upstreamnt  +downstreamnt
gtgaaccgtcgccgactacgcttctggctgctgctcgtctgctttgccatcagtctttcc
agtattgcccgcgccgccgcccatgagccgctggtggtgtgttttggagacagcatcacc
gccggtcacggactcgacccaagccaagcctatcctgttttcctgcagcatgacctggcc
tcgcgcggatatcactaccgcgtcatcaacgccggcgtgagcggcaacaccaccaaagac
gcactcgaccgcctgccgcgcgtgctcgggctgcatccggcggccgtcatcgtcgagttc
ggcggcaacgacgggctgcgcggctttccgctgaatgtgaccgagcgcaacctcggcacg
ctggtgggccgcctgcgcgccgcgcacattcccgtgctgctggccggcatcacgctgccg
cccaactacggccaagactacattcatcaattcgatgaaatgtaccgccgcgtggctcag
aaatatcacgtgcctttgctgcccatgctctacgcaggcatctacaacctgcccggaacc
atccagccggacggcattcaccccacggccaagggctcgcggctcatcgcccagcacctg
ctgccgctgctgctgcccctgctgcaccggaaatga

DBGET integrated database retrieval system