KEGG   Acidobacterium capsulatum: ACP_1014Help
Entry
ACP_1014          CDS       T00868                                 

Definition
glycosyl transferase family protein
Orthology
K01179  
endoglucanase [EC:3.2.1.4]
Organism
aca  Acidobacterium capsulatum
Pathway
Starch and sucrose metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:aca00500]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1170868..1172484)
Genome map
AA seq 538 aa AA seqDB search
MQWAAHERGDARSFRVLQMKPDGTPGKRVHQGPLSAALQDELSGDRVQLADFSAVKEAGR
YRLEVEHGDPSASSLEFAVGDDVLRDPLRLAMRAYYGQRCGCEVNLGGGYEHPPCHLKDA
FDATSGKTGLFQNYGGWHDAGDYGRYIVNSGISTGTLLWAWEMYRDQLQPMQLQIPESGG
STPDFLAEVRWNLTWMQALQDKDGGVWDKQTSLHFCGFIMPQDDALVSYVIGSGEPPYKI
ATASADFAAVMAIAARVYREFDPVFADACLDAAKRAWTWAMAHKDALFLKNPPTVSTGAY
GDAHDSDELLWASAELWRTTGDAQYEAPVLARWRALEKPLQMDVPSWGNVASMAWWTYAM
AEHHGQLRGDAKLVAQIHASTIGAADGLVKQSRKNGYGQTLAEADYDWGSNGTAGNQGLL
LLMAHRFHPQGEYREAARGNLHYLLGRNCFGVSWVTHVGTNPFQHPHHRPSVADGIAAPW
PGLLSGGPNRHPGDPAAKTVPTQPPMRMWLDDWQAFSMNEVAINWNAPLVFTLAGAQG
NT seq 1617 nt NT seq  +upstreamnt  +downstreamnt
gtgcagtgggctgctcatgagcgtggagacgcgcgatcgtttcgcgtgctgcagatgaag
ccggacggcacgccgggcaagcgcgtgcatcaagggccgctgagcgcggcgctgcaggac
gagttgagcggggaccgcgtgcagcttgcggatttttcagcggtgaaggaagcagggcgg
taccggctcgaagtggagcatggcgacccatcggcgtcgtcactggagtttgcagtgggc
gatgatgtgctgcgcgatccgctgcggctggcgatgcgcgcctattatgggcagcggtgc
ggctgcgaggtgaatctgggcggcgggtatgagcatcctccctgccatttgaaagatgct
tttgacgcgacctcgggcaagaccgggctgtttcagaattacggcggatggcacgatgcg
ggcgactatggccgctacatcgtgaattcgggaatctcgacgggcacgctgttgtgggcg
tgggagatgtatcgcgatcaactgcaaccaatgcagttgcaaattccggaatcgggcgga
tcgacgccggattttctggcggaagtgcgctggaacctgacctggatgcaggcgctgcag
gacaaggacggcggcgtgtgggacaaacagaccagcctgcacttctgcggtttcatcatg
ccgcaggatgatgcgctggtgagctatgtgatcggctctggcgagccgccttacaagatt
gcgacggcctcggccgattttgccgccgtgatggcgattgcagcgcgagtgtatcgcgag
tttgatccggtctttgccgacgcgtgtcttgatgcggccaagcgggcgtggacctgggcg
atggcgcataaggatgcgttgttcctgaagaatccgccgacggtttcaactggcgcttat
ggagacgcgcacgacagcgatgagttgctgtgggcatccgccgagttgtggcgcaccacc
ggcgacgcgcagtatgaggcgcctgtgctggcccgctggcgggcactcgaaaagccgctg
cagatggatgtgccgagctggggcaatgtggcttcgatggcctggtggacgtatgcgatg
gcggagcatcacggtcaattgcgtggcgatgcgaagctggtagcgcagattcatgcgtcg
accattggcgcggcggatggcctggtgaagcagagccggaagaatggctatgggcagacg
ctggccgaggccgattacgattggggatcgaatggcacagcaggaaatcagggattgctg
ctgctgatggcgcatcgctttcatccgcagggcgagtatcgcgaggctgcgcggggcaat
ctgcattatctgctggggcgcaattgctttggcgtttcgtgggtgacgcatgtgggcacg
aatccgtttcagcatccgcaccaccggcccagtgtggcggatggcatcgcggctccgtgg
cccgggttgctttccggcgggccgaaccggcatccgggggatccggcagcgaagacagtg
cccacgcagccgccgatgcgcatgtggctcgatgactggcaggccttcagcatgaacgag
gtggcgatcaactggaacgctccgctggtgtttacgctggcgggcgcacaggggtaa

DBGET integrated database retrieval system