KEGG   Acidobacterium capsulatum: ACP_1061Help
Entry
ACP_1061          CDS       T00868                                 

Gene name
malQ
Definition
4-alpha-glucanotransferase (EC:2.4.1.25)
Orthology
K00705  
4-alpha-glucanotransferase [EC:2.4.1.25]
Organism
aca  Acidobacterium capsulatum
Pathway
Starch and sucrose metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:aca00500]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1224254..1225801
Genome map
AA seq 515 aa AA seqDB search
MAMDRSSGLLLHVTSLPSHGGIGDLGPAAYAFADFLAAAKQQWWQVLPLGPTGYGNSPYA
GLSAFAGNPLLVSLEFLAEWGWMDRERLGELPGHDGHVDFEAVSARKLPLLEEAARNFLA
RRASHEEQGEQWERFERFRAANSGWLPDWVLYSVLRRKFGYACWNEWPEAVARREPEALE
AARKELAAEIAVAEAIQFAFDEQWTRLREYCAERGIRFLGDIAIFVNFDSADVWAYPEIF
DLDEKLSPVRVAGVPPDYFSATGQRWGNPLYRWDVLERQGFAWWVERVRRARVLYDAMRL
DHFRGFEAYWSIPAEEETAVNGEWVKAPGDALFETLARELGELPFLAEDLGVITPEVDAL
RERFGLPGMRVLQFGFSGRGAHMHLPHRYEKNSVVYTGTHDNDTTRGWWEHGASREEKAA
VEVYLHPGLDASEHGVVWAMIRAAATSVADICLYPVQDVLELGSEARMNVPARAKGNWGW
RVGEGAWNDDVAAKLALLTEVTDRDRLPDEDSQEA
NT seq 1548 nt NT seq  +upstreamnt  +downstreamnt
atggccatggaccgctcatctggactcttgctgcacgtgacttccctgccctcgcacggc
ggaattggcgatctgggcccggcggcctatgcctttgccgattttctggcggcggccaaa
cagcagtggtggcaggtgctgccgctggggccgacgggctatgggaattcgccgtatgcg
gggttgtcggcgtttgcgggcaatccgctgctggtttcgctggagtttctggcggagtgg
ggctggatggaccgggaacggctgggcgagttgccggggcatgacgggcatgtggacttt
gaagcggtgagcgcgcggaagctgccgctgctcgaggaggcggcgcggaactttctggcg
cggcgggccagccatgaggagcaaggcgagcagtgggaacggtttgagcggtttcgcgcg
gcaaactcaggctggctgccggactgggtgctctacagcgtgctgcggcggaagtttggc
tatgcctgctggaatgagtggcccgaggccgtggcgcggcgggagccggaggcgctggaa
gccgcgcgaaaggagctggcggcggagattgccgtcgcggaggcgattcagtttgccttt
gatgagcaatggacgcggctgcgggagtattgcgcggagcgcggcatccgttttctgggc
gacattgcgatttttgtgaacttcgacagcgcggatgtgtgggcgtatccggagattttt
gatctggatgagaagctgtcgccggtgcgggtggcgggtgtgccgccggactacttctcg
gcgacgggacagcgctggggcaatccgctttaccgctgggatgtgctggaacggcagggc
tttgcgtggtgggtggagcgggtgcgccgggcgcgggtgctgtatgacgcgatgcggctg
gaccacttcagaggatttgaggcgtactggtcgattccggccgaggaagagacggcggtg
aacggcgagtgggtgaaagctccgggcgacgcgctgtttgagacgctcgcgcgggagctg
ggcgagttgccgtttctggccgaggacctcggcgtgattacgccggaggtggatgccctg
cgggagcgctttgggctgccggggatgcgggtgctgcagtttggattttctggccggggc
gcgcacatgcacctgccgcatcgctatgagaagaattccgtggtgtacacggggacgcac
gacaacgacacgacgcgcggctggtgggagcatggtgcgagccgcgaagagaaagcggcg
gtcgaggtgtatctgcatccggggctggatgcgtcggaacatggggtggtgtgggcgatg
attcgcgcggcggcgacctcagtggcggatatttgtttgtatccggtgcaggatgtgctg
gagctgggatcagaagcgcgcatgaacgtgccggcgcgagccaagggtaactggggctgg
cgcgtgggcgaaggtgcctggaatgacgacgtggcggcaaagctcgccctgctgaccgaa
gtgaccgaccgggaccggctgccggatgaggattcgcaggaggcgtaa

DBGET integrated database retrieval system