KEGG   Acidobacterium capsulatum: ACP_1091Help
Entry
ACP_1091          CDS       T00868                                 

Gene name
murE
Definition
UDP-N-acetylmuramoylalanyl-D-glutamate--2,6-diaminopimelate ligase (EC:6.3.2.13)
Orthology
K01928  
UDP-N-acetylmuramoyl-L-alanyl-D-glutamate--2,6-diaminopimelate ligase [EC:6.3.2.13]
Organism
aca  Acidobacterium capsulatum
Pathway
Lysine biosynthesis
Peptidoglycan biosynthesis
Class
Metabolism; Amino acid metabolism; Lysine biosynthesis [PATH:aca00300]
Metabolism; Glycan biosynthesis and metabolism; Peptidoglycan biosynthesis [PATH:aca00550]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1255423..1256931)
Genome map
AA seq 502 aa AA seqDB search
MQFSQALAGVDTTARSGPDPELTGVEYDSRRVTPGALFVAMRGETVDGNRYIGAAIEKGA
GAILTDSAEAMATWSLRTDVAIAQVPHGRQAMALVAANFFGHPERQLAVSGVTGTNGKTT
TTFLLESLLQHAQRKTALVGTIEYHLAGQVLPSPHTTPESRDLLALFRQGVDAGVTEAVM
EVSSHALAQGRVYGIPYDVAIFTNLTRDHLDFHGSMQQYFAAKRMLFDASLGQPPRVSVL
NLEDPHGAELALTAREHGSEIYSYGFNTGEFRAEDVQLSGGGMRFHWHTPFGHAPVTTRL
IGRVNVYNLLAASAGALARGLAFDQVVESVAHLHSVPGRFQTIDEGQPFTVVVDYAHTDD
ALRNLIALARDLVHKHKGRVITLFGCGGDRDRTKRPLMGQAAAEGSDVVVLTSDNPRSED
PEAILADVLPGLTVPRTWYMLEPDRARGIRMALEIAQPGDIVLLAGKGHEKTQTLRHGTI
PFDDVAVAAAVLREMRFAGASQ
NT seq 1509 nt NT seq  +upstreamnt  +downstreamnt
atgcaattcagtcaggcccttgccggagtcgacaccaccgctcgctccgggcccgacccg
gaactgaccggagtcgagtatgattcgcgccgcgtaacccccggcgcgctcttcgttgcc
atgcgcggagaaactgtggatggcaatcgttatatcggcgccgctattgaaaaaggcgca
ggcgccatcctcaccgattctgctgaagcgatggccacatggtcgctgcggaccgatgtc
gccatcgcgcaggtgccgcatggtcgccaggccatggcgctcgtggcggcaaacttcttc
gggcatccggaacgccaactggccgtcagcggcgtcactggaaccaacggcaaaaccacc
accacgtttctcctggaaagcctgctgcagcatgcgcagcgcaaaactgcattggtcggc
accatcgaatatcatctggccggtcaggtgctgccctcgccgcacaccacgccggagtcg
cgcgacctgctcgcactctttcgtcaaggtgtcgatgccggtgtcaccgaagccgtcatg
gaagtctcctcgcacgcgctcgcgcaggggcgcgtctacggcatcccttatgacgtggcc
atcttcaccaatctcacccgcgaccatctggactttcacggcagcatgcagcagtatttc
gccgctaagcggatgctgttcgacgcaagccttggccagccgccgcgtgtttctgttctc
aatcttgaagatccgcacggggcagagctggccctcacggcgcgcgagcacggcagcgaa
atctactcctatgggttcaatacgggagaatttcgcgccgaagacgtgcagttgagcggc
ggtggcatgcgcttccactggcacacaccctttggtcacgcgccggtcacaacaaggctg
atcggccgcgtcaacgtctacaacctgctcgccgccagcgcgggggccctcgcccgggga
ctcgcctttgaccaggtggtcgaaagcgtggctcacctgcacagtgtgcccggccgcttt
cagaccatcgatgagggccagcccttcaccgtggtcgtggattacgcccataccgatgat
gcgcttcgcaatctgattgcgctggcccgcgacctggtccacaagcataaggggcgcgtc
atcaccttgtttggctgcggcggcgaccgtgaccgcaccaagcgcccgctcatggggcag
gctgctgcggagggcagcgacgtggtggtgctcacctccgacaacccgcgcagcgaagat
cccgaagccattctggccgacgtgctgcccggcctcaccgtgccgcgcacttggtacatg
ctggagcccgaccgcgcgcgcggcattcgcatggccctcgagattgcccagcccggcgat
atcgtattgctggccggcaaagggcatgagaagacacagacgctccggcacggtacgatt
ccattcgacgatgttgccgtggccgcagccgtgctgcgtgagatgagattcgccggagcc
tctcaatga

DBGET integrated database retrieval system