KEGG   Acidobacterium capsulatum: ACP_1714Help
Entry
ACP_1714          CDS       T00868                                 

Definition
magnesium chelatase, ChlI subunit
Orthology
K03405  
magnesium chelatase subunit I [EC:6.6.1.1]
Organism
aca  Acidobacterium capsulatum
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of cofactors and vitamins; Porphyrin and chlorophyll metabolism [PATH:aca00860]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2037544..2039067
Genome map
AA seq 507 aa AA seqDB search
MTSRHLPQTLGELRSSKTYSEARLGARSVKDELRENLIARLRAKETIFPGIVGYEDTVVP
QIVNAVLSRQNFILLGLRGQAKSRMLRALTALLDEQMPYVAGCEIRDNPYRPLCSRCRAL
IAEKEEATPIAWLHRDERYIEKLATPDVTVADLIGDLDPIKAARGGHDLSSDLAMHYGLL
PRANRGIFAVNELPDLAGKIQVALFNIMQEGDVQIKGFPVRLELDVALVFSANPEDYTAR
GKIVTPLKDRIGSEIRTHYPESLEEGISITAQEAWTERGLGQVEVPQYLREIVEQIAFSA
REEKKVDKRSGVSQRLPISTMELVLSNAERRALTHGEERIVPRVGDVYAALPGITGKVEL
EYEGELKGADAVVKEIVRTAIGKTFDRYFADVNTQQIEQWFNLGGTIKISDGQGAQATHE
ELKQIQGLTEKLSPLGIKASTDAEHYVGAAEFLLEGMCAHRRLSRNEERGFGLQRKEKNR
AERQEQASDEQEYEAWQQRRNRRGSFN
NT seq 1524 nt NT seq  +upstreamnt  +downstreamnt
atgacctcacgccatctgccccagaccctgggggagcttcgctcaagcaaaacatactcg
gaagcacgtctgggagcacgctcagtgaaagacgagctgcgcgaaaacctgattgcacgg
ctgcgcgccaaggagacgatcttcccgggcattgtgggctatgaggacacggtggttccg
caaattgtgaatgcggtgctgtcgcggcagaacttcatcctgttgggactgcgcgggcag
gccaagagccgcatgctgcgtgcgctgaccgcgctgctggatgagcagatgccctatgta
gccggatgcgagattcgcgacaacccctatcgcccgctgtgcagccgctgccgtgcactg
attgcagagaaggaagaggcgaccccgattgcatggctgcatcgcgatgagcgctacatt
gaaaagctggcgacacccgatgtgacggtggccgacctgattggcgatctggacccgatc
aaggcggcgcgcggagggcatgacctgtcgagcgatctggcgatgcactacggactgctg
ccccgcgccaatcgcggaatttttgcggtgaatgaattgccggacctggcaggcaagatt
caggtggcgctctttaacatcatgcaggaaggcgatgtgcagattaagggctttccggtg
aggctggaactggatgtggcgctggtcttcagcgcgaatcctgaggactacacggcgcgc
ggcaagattgtgacgccactcaaggaccgcatcgggtcggagattcggacgcattatccg
gaatcgctcgaagagggcatctcgatcacggcgcaggaagcatggaccgagcgcggcctg
ggccaggtggaagtgccgcagtatctgcgcgagattgtggagcagatcgccttcagcgcg
cgcgaagaaaagaaagtggacaagcgcagcggcgtgagccagcgcttgcccatttccacc
atggaactggtgctctcaaacgccgaacgccgcgcgctgacgcatggcgaagaacgcatt
gtgccgcgcgtgggtgatgtgtatgctgcgctgcccggcattaccggcaaggtggagctg
gagtacgaaggcgagttgaagggcgccgatgccgtggtaaaggagattgtgcgcactgcc
attggcaagacctttgaccgctactttgccgacgtgaacacgcagcagatcgagcagtgg
tttaacctgggcggcaccatcaagatcagcgatggacagggggcacaggccacgcatgaa
gagttgaagcagattcagggactgacggagaagctgtcaccgctcggcatcaaagcctcg
accgatgccgagcattatgtgggcgcggccgaatttctgctggaaggcatgtgcgcgcac
cgccgcctgagccgcaatgaggaacgcggatttgggctgcagcgcaaagagaaaaatcgc
gcggagcggcaggagcaggccagcgacgagcaggagtatgaagcgtggcagcagcggcgc
aaccgccgcggcagctttaactag

DBGET integrated database retrieval system