KEGG   Acidobacterium capsulatum: ACP_1769Help
Entry
ACP_1769          CDS       T00868                                 

Gene name
trpA
Definition
(GenBank) tryptophan synthase, alpha subunit
  KO
K01695  tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
aca  Acidobacterium capsulatum
Pathway
aca00260  Glycine, serine and threonine metabolism
aca00400  Phenylalanine, tyrosine and tryptophan biosynthesis
aca01100  Metabolic pathways
aca01110  Biosynthesis of secondary metabolites
aca01130  Biosynthesis of antibiotics
aca01230  Biosynthesis of amino acids
Module
aca_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:aca00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    ACP_1769 (trpA)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    ACP_1769 (trpA)
Enzymes [BR:aca01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     ACP_1769 (trpA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Trp_syntA His_biosynth DUF3665
Motif
Other DBs
NCBI-ProteinID: ACO33439
UniProt: C1F7N7
Position
complement(2102830..2103603)
Genome map
AA seq 257 aa AA seqDB search
MPIRFQHKPGLVVYLTVGDPDLETTRRVALAAIDAGAEVLELGVPFSDPLADGPVIQAAS
ERALKHGTRMSDVLALAADLRRERPETGLIVFSYLNPILRFGLERFCAEAEAAGVDGVLA
TDMIVEESAEYLEHLRRHHLAPIFLVAPTSPDERLKKIAAVTDGFIYAISRVGITGTQSS
LASEAEPLVQRLRQYTSLPIAVGFGVSNADHVAEVGRFADAAVIGSAIVANIEKAGRTEA
PSSIARFIEGLRPSVPA
NT seq 774 nt NT seq  +upstreamnt  +downstreamnt
gtgccgattcgctttcaacacaaacccggactggtggtgtatctcacggttggcgatcct
gacctggagaccacgcgccgggtggcgctggccgcgattgacgcgggcgctgaagtgctg
gagctgggcgttccgttcagcgatccgctggccgatgggccggtgattcaggccgcgagc
gaacgcgcgctgaagcacggcacgcggatgagcgatgtgctggcgctggccgccgatctg
cgccgcgagcggcccgagaccgggctgattgtcttttcgtatctgaatcccattctgcgc
tttgggctggagcgcttctgcgccgaggccgaggctgccggggtggatggcgtgctggcc
accgacatgatcgtggaagagtcggccgaatatctggagcatctgcggcggcatcatctc
gcgccgatttttctggtcgcgccgaccagccccgacgagcgcctgaagaagattgccgcc
gtcaccgacggatttatctatgcgatttcgcgcgtcggcatcacgggcacgcagagttcg
ctggcctctgaagccgagccgctggtccagcggctgcgccagtacacaagcctgcccatt
gctgtgggctttggcgtctccaacgcggatcacgtggccgaggtgggccgctttgccgat
gccgcagtgatcggcagcgccattgtggcgaatattgaaaaggcgggccgcaccgaagcg
cccagctcgatcgcacgatttatcgagggcctgcgcccctccgtgcctgcctga

DBGET integrated database retrieval system