KEGG   Acidobacterium capsulatum: ACP_1770Help
Entry
ACP_1770          CDS       T00868                                 

Gene name
trpB
Definition
(RefSeq) tryptophan synthase subunit beta (EC:4.2.1.20)
  KO
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
aca  Acidobacterium capsulatum
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:aca00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    ACP_1770 (trpB)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    ACP_1770 (trpB)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    ACP_1770 (trpB)
Enzymes [BR:aca01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     ACP_1770 (trpB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2103610..2104830)
Genome map
AA seq 406 aa AA seqDB search
MSTVVNPDLTASGNVAGRFGAYGGRYVPETLVAALDELEHAYAEAQADPEFHARLDALLT
DYAGRPTPLYFAERLTEKLGGARIYLKREDLLHTGAHKINNCIGQGLLAQRMGKQRIIAE
TGAGQHGVATATVCALLGLECVVYMGEEDMRRQELNVYRMRLLGAEVRGVTSGSRTLKDA
INEAMRDWVTNVRTTHYLLGSVLGAHPYPMMVRDFHRVISKEARRQILEKENRLPTAVIA
CVGGGSNAIGAFYEFIPDKDVRLIGVEAGGSGERLGTHAARFRGGAPGVLQGTYSYVLQD
DDGQVALTHSVSAGLDYASIGPEHAALHDSGRAEYTAASDEQALEATVTLARTEGILPAL
ESAHAVAECIRLAPTLGRHDILMVNLSGRGDKDMGILARELKLKGA
NT seq 1221 nt NT seq  +upstreamnt  +downstreamnt
atgagcaccgtggtgaatccagacttgaccgcatccggcaacgtggccggccgctttggc
gcgtatggcgggcgctatgtgcccgaaacgctggtggccgcactcgatgaactggagcat
gcctatgccgaggcgcaggccgatccggagtttcatgcgcgcctggatgcgctgctgacc
gactacgccggccgcccgacgccgctgtattttgccgagcggctcactgagaagctgggc
ggggcgcgcatttacctcaagcgcgaagacctgctgcacaccggcgcgcacaagatcaac
aactgcatcgggcaggggctgctggcgcagcgcatgggcaagcagcgcatcattgccgag
accggcgcgggccagcacggcgtggccacggccaccgtttgcgcgctgctgggcctggag
tgcgtggtctacatgggcgaggaagatatgcgccgccaggagctgaacgtctaccgcatg
cggctgctgggcgccgaagtgaggggcgtgacgtcaggctcgcgcacgctcaaggacgcc
atcaacgaggccatgcgcgactgggtcaccaatgtacgcacgacacactatctgctcggt
tcagtgctgggcgcgcatccttacccgatgatggtgcgtgactttcatcgcgtgatcagc
aaagaggcgcggcggcagattctggaaaaggaaaaccgcctgcccacggccgtgattgcc
tgtgtcggcggcggctccaatgcgattggcgcgttttatgaatttattccggacaaggat
gtgcggctgatcggcgtggaggccggtggcagcggcgagcggctgggcacgcatgcggcg
cgttttcgcggcggtgcgccgggcgtgctgcagggcacgtactcgtatgtgctgcaggac
gacgacggccaggtggcgctgacgcactcggtttccgcgggactcgactacgcctcgatc
ggccctgagcatgccgcgctgcatgattccggccgcgccgagtacaccgcagcctcagac
gagcaggcgctcgaggccaccgtcacgctcgcgcgcaccgagggcattttgcctgcgctc
gagagcgcgcatgccgtggcggaatgcattcgtcttgcgccgaccctcggtcgtcatgac
atactaatggtcaacctctcaggtcgtggcgataaggatatgggtattctcgcgcgcgag
ctgaagttgaagggagcctga

DBGET integrated database retrieval system