KEGG   Acidobacterium capsulatum: ACP_1820Help
Entry
ACP_1820          CDS       T00868                                 

Gene name
asnB2
Definition
asparagine synthase (EC:6.3.5.4)
Orthology
K01953  
asparagine synthase (glutamine-hydrolysing) [EC:6.3.5.4]
Organism
aca  Acidobacterium capsulatum
Pathway
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Amino acid metabolism; Alanine, aspartate and glutamate metabolism [PATH:aca00250]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2155491..2157317
Genome map
AA seq 608 aa AA seqDB search
MCGIAGLISFSTAEDVVGLSSRPDTLSQALASRGPDAHNRWISPGRHAALDHRRLSIIDL
HSRADQPMISDDGRYAIVFNGEIYNYAELRSELTGRGVRFHTTGDTEVLLQMFAQYGPAM
LPRLRGMYAFAIWDEPEQRAFLARDPLGIKPLYYARSRERLYFASQVRALLTVPGLDLSE
QPAGHVGFFLWGSVPEPYTLYRGIHCLPAGHWMTVDRSGETTVRKFASPVEEFGQYRLEE
MPGSDAECKSRLHAALAGSVRAHQTADVPCAIFLSAGIDSSVITALSAEQGLPATTLTLG
FDMLRGSENDEVPLAQIIARHYDTPNHPQYIGQPFFLEHRDRILEQMDQPTIDGVNTYLV
SWLARQFGFKVALSGIGGDEVFGGYPSFQQIPQTVHALAPLAHAPFLGRGWRILTAGVMR
RFTSAKYAGLFEYGGTWGGAYLLRRGLYMPWELPAFLDADLVRAGWEQLHSIPAMNALVH
LVDRLPFAESGQADFLRISALEMTYYMRSQLLRDADWAGMAHSVEIRVPFVDMFLLRQLA
PLRASRFFPRKPAYAECLSRPLPASILHRPKTGFHVPVREWMQQETERGLRPWSRFVYRA
KFASAGSD
NT seq 1827 nt NT seq  +upstreamnt  +downstreamnt
atgtgtgggattgccggacttatttccttttctactgccgaagatgttgtcggcctgtcg
tcacgacccgacacgctttcacaagcattggcctctcgaggcccggatgctcacaaccgt
tggatttctcccggacggcatgccgcactcgatcaccggcggctctcgatcattgatctt
cactcccgcgcagatcagccaatgatttcagacgatggccgctacgccatcgtttttaac
ggagagatttataactacgcagaattgcgcagcgagttgacaggccgtggcgtgcgcttt
cacaccacaggcgacaccgaagtgctgttgcagatgtttgcccagtatggtccggccatg
ttgccgaggctgcgcggcatgtacgcgttcgccatctgggacgagccggagcaacgggcg
tttcttgcgcgcgaccctctcggcatcaagcctctttactatgcgaggagccgcgagcgg
ctgtactttgcatcgcaggtgagggccctgctcacagtgccgggccttgacctcagcgaa
caacctgccgggcatgtcggcttctttctatggggatcggtgccggaaccttacacgctc
tatcgcggcattcattgcctgccggccggccactggatgaccgtagacagaagcggtgaa
acgaccgtaagaaagtttgcctctcccgtggaggagtttggccaatatcgactggaagaa
atgcccggtagcgatgcggaatgtaaatcgcgcctgcacgcggcattggccgggagtgtg
cgcgcgcatcaaacggccgatgttccgtgcgctatctttctctccgcgggaattgattcc
tcggtcataacggctttgagcgcggagcagggtctgccggccaccacgctgactctgggt
tttgacatgcttcgtggctctgagaacgatgaggttccactcgcccagatcatcgcaagg
cattacgacacgcccaaccacccgcaatacatcgggcagccattttttctggagcatcgc
gaccgcatccttgagcagatggatcagccgaccatcgatggagtcaacacctacctggtg
agttggctggctcggcaattcgggtttaaggtcgcgctcagcggaattggcggcgatgag
gtctttggcggctatcccagttttcagcagattcctcaaaccgtgcatgccctggcgcct
ctggcccatgctccgtttctagggcgcggctggcgcatcctcacggctggcgtcatgcgc
cgctttacctctgcaaaatacgcaggcttgtttgaatatggcggcacatggggaggagcc
tatctgctgcgccgcggcctttacatgccctgggagctgcccgcgtttcttgatgcggat
ctggtgcgcgccgggtgggagcagttgcactccattcccgccatgaatgcgctcgttcat
ctcgtggacagactgcccttcgccgaaagcggccaagctgactttctgcgcatctccgcg
ctggagatgacctattacatgcgcagccaactactgcgggatgccgactgggctggaatg
gcgcattccgtggagatacgcgtgccctttgtggatatgtttctgcttcgccaactggcg
ccgctgcgcgcgagccgattttttccgcgcaagcccgcctatgccgaatgcctcagcagg
ccgctgcccgccagcattctccatcggccgaagacgggcttccatgtgccggtgcgcgag
tggatgcaacaggagaccgaacgcggattgaggccatggtcccgctttgtgtatcgcgcc
aaatttgcttcggccggcagtgactaa

DBGET integrated database retrieval system