KEGG   Acidobacterium capsulatum: ACP_1837Help
Entry
ACP_1837          CDS       T00868                                 

Definition
delta-9 desaturase (EC:1.14.19.1)
Orthology
K00507  
stearoyl-CoA desaturase (delta-9 desaturase) [EC:1.14.19.1]
Organism
aca  Acidobacterium capsulatum
Pathway
Biosynthesis of unsaturated fatty acids
Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:aca00001]
 Metabolism
  Overview
   01212 Fatty acid metabolism
    ACP_1837
  Lipid metabolism
   01040 Biosynthesis of unsaturated fatty acids
    ACP_1837
Enzymes [BR:aca01000]
 1. Oxidoreductases
  1.14  Acting on paired donors with incorporation of molecular oxygen
   1.14.19  With oxidation of a pair of donors resulting in the reduction of O2 to two molecules of water
    1.14.19.1  stearoyl-CoA 9-desaturase
     ACP_1837
Lipid biosynthesis proteins [BR:aca01004]
 Desaturase
  First
   ACP_1837
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2171222..2172079
Genome map
AA seq 285 aa AA seqDB search
MQADAQHFVQSKSKALNFSFAAVLTLMHVGAIAALFYFKWSAVGAFLVMWVIAQNIGIAM
SYHRLLTHRGYVVPKWLEYTMAICSTMAMQGGPIYWVAVHRLHHQLTDKPGDPHSPRDGV
WWSHVGWILYGTLHNGDPALARYAPDLIRDRFYVWLSRFHLVPLALAGGVLYYFGGWSWL
LWGIPLRVVLGWHTTWLVNSATHLWGYRNFDTRDDSRNNVLVAIISGGEGWHNNHHAHPV
SATHGMAWYEIDVNYWGIRLLGFLGLAKKIKVQGLKGGPAKVLHG
NT seq 858 nt NT seq  +upstreamnt  +downstreamnt
atgcaggcggatgcccagcattttgttcaaagcaagtcgaaggcactcaacttttccttc
gccgctgttctcaccctcatgcacgtcggcgccatcgccgccctgttctacttcaagtgg
tctgccgtcggcgcgttcctggtcatgtgggtcatcgcgcaaaacatcggcatcgccatg
agctaccacaggctgctcacgcaccgtggttatgtggtgcccaaatggctggaatacacc
atggccatctgctccaccatggccatgcagggcggccccatctactgggtggccgttcat
cgcctgcaccatcagctcactgacaagcccggcgacccgcactccccgcgcgacggcgtg
tggtggtcgcatgtgggctggattctctacggcacgctgcacaacggcgatcccgcgctg
gcacgctacgcgcctgacctcattcgcgaccgcttctacgtctggctgagccgcttccac
ctggttccgctggcgctggccggcggcgtgctctattactttggcggatggtcatggctg
ctctggggcattcccctgcgcgtcgtgctcggctggcacaccacctggctggtcaactcg
gccacgcacctgtggggctaccgcaactttgatacgcgcgatgactcacgcaacaacgtc
ctcgtggccatcatctcgggcggcgaaggctggcacaacaatcatcacgcgcacccggtc
tcggccacccacggcatggcctggtatgagattgacgtcaactactggggcatccgcctg
ctcggcttccttggcctcgccaagaagatcaaggtgcagggcctcaagggcggacccgca
aaggtcctccacggctga

DBGET integrated database retrieval system