KEGG   Acidobacterium capsulatum: ACP_1868Help
Entry
ACP_1868          CDS       T00868                                 

Gene name
rfbC
Definition
(GenBank) dTDP-4-dehydrorhamnose 3,5-epimerase
  KO
K01790  dTDP-4-dehydrorhamnose 3,5-epimerase [EC:5.1.3.13]
Organism
aca  Acidobacterium capsulatum
Pathway
aca00521  Streptomycin biosynthesis
aca00523  Polyketide sugar unit biosynthesis
aca01130  Biosynthesis of antibiotics
Module
aca_M00793  dTDP-L-rhamnose biosynthesis
Brite
KEGG Orthology (KO) [BR:aca00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00523 Polyketide sugar unit biosynthesis
    ACP_1868 (rfbC)
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    ACP_1868 (rfbC)
Enzymes [BR:aca01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.13  dTDP-4-dehydrorhamnose 3,5-epimerase
     ACP_1868 (rfbC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: dTDP_sugar_isom
Motif
Other DBs
NCBI-ProteinID: ACO34129
UniProt: C1F861
Position
complement(2205308..2205853)
Genome map
AA seq 181 aa AA seqDB search
MEITPTALPEVLVIRPRIFRDDRGSFWETWNERTIAEAGLPAEWKQDNTSVSKKNVVRGI
HYQILQPQGKLVRAAAGRILDVAVDLRRSSPNFGKHIAVELSGDDSAMLWIPVGFGHAFV
ALTDDARVAYKVTDYYSPAGERTILWNDPQIGIDWPVRADEAIVSAKDADGKRLADAEVF
A
NT seq 546 nt NT seq  +upstreamnt  +downstreamnt
atggagattacaccgaccgcattgccggaagttttggtgattcgcccccgtattttccgc
gatgatcgtggctccttttgggagacctggaacgagcgaacaatcgccgaggccggtctg
cctgcagagtggaagcaggacaatacttcagtttccaaaaagaatgtggtgcgtggcatt
cattaccagattcttcagccgcaagggaagctggtgcgtgccgctgcgggccgcattctc
gatgtcgctgtcgatctgcggcggagttcgccgaactttggaaaacatatcgccgtggaa
ctctcgggtgatgacagcgccatgctgtggattccagtcggcttcgggcatgcctttgtg
gcccttacggacgatgcccgggtcgcctataaagtgacggactactactctccggcggga
gagcgcaccatcctgtggaatgacccgcagatcggcatcgattggccggttcgggcagat
gaagctatcgtttccgcgaaggatgcagacggcaagcgtctggccgatgccgaggtcttc
gcctga

DBGET integrated database retrieval system