KEGG   Acidobacterium capsulatum: ACP_1970Help
Entry
ACP_1970          CDS       T00868                                 

Definition
O-glycosyl hydrolase, family 30
Orthology
K01201  
glucosylceramidase [EC:3.2.1.45]
Organism
aca  Acidobacterium capsulatum
Pathway
Other glycan degradation
Sphingolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:aca00001]
 Metabolism
  Lipid metabolism
   00600 Sphingolipid metabolism
    ACP_1970
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    ACP_1970
Enzymes [BR:aca01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.45  glucosylceramidase
     ACP_1970
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2315910..2317319
Genome map
AA seq 469 aa AA seqDB search
MKTKAACWLLSLALPLSTSLLAGAQQIPAAHEWLTTASRSALFAEQPGSLAFASPANQLP
VIDVNDMQQFQSMLGFGCALTGGSARLLMQMGASQRHALLEQLFAKQGNGIHISFLRVSI
GSSDMNTHAYTYDDLSQGETDASLSHFSLDPDMHTVIPVLKEILAINPDIKILGSPWSAP
AWMKTDDSLKGGHLKKEDYPVYARYFVKYLEAMRSHGIHIYAITVQNEPLNPKNLPSMVM
FAPEEAAFIANDLGPALHKVGLDTRIWVYDHNPDVPSYPLSILGDSAASGYVDGTAFHLY
GGTAATFTKVHNEYPNKNLYMTEQSVGSPHTGPLPIAETLQRVAIDSSRNWSRNVLYWNL
AADPNDGPHTNDGGCTGCQGALTLDGNQVTDNLAYYAMAHFSKFVPPGSVRIGSSQHEQL
FTAAFRTPDGHIVLVAANTGNFAKPIDVKYHGQWFQTTLPEESAATYVW
NT seq 1410 nt NT seq  +upstreamnt  +downstreamnt
atgaagaccaaagcggcctgctggctgctgtctctcgcccttccgctgagcacgagcctg
ctggccggcgcgcagcagattcctgccgcgcacgaatggctcaccacggcttcccgctcg
gcattgtttgccgagcagcccggctcgctcgcatttgcttcccctgccaatcagttgccc
gtgatcgatgtcaacgacatgcagcagttccagtccatgctgggcttcggctgcgcgctc
accggcggcagcgcgcgcctgctcatgcagatgggcgcaagccagcgccacgctttgctg
gagcagcttttcgccaaacagggcaatggcattcacatcagctttctgcgtgtcagcatc
ggctcctctgacatgaacacccatgcctacacctatgacgatctgtcgcagggcgagacc
gatgcttcgctcagccacttcagtcttgatcctgacatgcacaccgtcattccggtgctc
aaagagattttggccatcaatcccgacattaagattctcggctcgccctggtccgcgcct
gcatggatgaagaccgatgacagcctcaagggcggccacctcaaaaaagaggactacccc
gtctacgcccgctattttgtgaagtacctcgaagccatgcgctcgcacggcattcacatc
tacgccatcaccgtgcagaacgagccgctcaatcccaaaaatctgcccagcatggtcatg
ttcgcgcccgaggaagccgccttcatcgccaacgatctcggccccgcgctccacaaagtc
ggcctcgataccaggatctgggtctatgaccacaatcctgatgtgccgtcctatccgctc
tctatcctgggcgattctgcagccagcggctacgtcgatggcacggccttccacctctat
ggaggcaccgcggccaccttcaccaaggtgcacaacgaatatccgaacaagaacctctac
atgaccgagcaatccgtcggcagcccgcacaccgggccgctgcctatagcggaaaccctc
cagcgcgtcgccatcgactcctcccgcaactggagccgcaacgtgctctactggaacctc
gccgccgaccccaacgacggccctcacacgaacgatggcggctgcactggatgccagggt
gccctcacgctcgacggcaatcaggtcaccgacaatctcgcttactatgccatggcgcac
ttttcaaagttcgtgccgcccggctcagtccgtatcggctccagtcagcatgagcagctt
ttcaccgccgccttccgcacgccagacggccacatcgtgctcgtcgccgcaaacaccggc
aacttcgccaagcccattgacgtgaaataccacggtcaatggttccagaccacgctgcct
gaggaatcggccgccacctacgtctggtag

DBGET integrated database retrieval system