KEGG   Acidobacterium capsulatum: ACP_2079Help
Entry
ACP_2079          CDS       T00868                                 

Gene name
galU
Definition
(GenBank) UTP-glucose-1-phosphate uridylyltransferase
  KO
K00963  UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
aca  Acidobacterium capsulatum
Pathway
aca00040  Pentose and glucuronate interconversions
aca00052  Galactose metabolism
aca00500  Starch and sucrose metabolism
aca00520  Amino sugar and nucleotide sugar metabolism
aca01100  Metabolic pathways
aca01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:aca00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    ACP_2079 (galU)
   00052 Galactose metabolism
    ACP_2079 (galU)
   00500 Starch and sucrose metabolism
    ACP_2079 (galU)
   00520 Amino sugar and nucleotide sugar metabolism
    ACP_2079 (galU)
Enzymes [BR:aca01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     ACP_2079 (galU)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NTP_transferase NTP_transf_3 IspD
Motif
Other DBs
NCBI-ProteinID: ACO33454
UniProt: C1F916
Position
2435581..2436456
Genome map
AA seq 291 aa AA seqDB search
MKSRVRKAVFPAAGFGTRFLPATKSIPKEMLPLVDKPIIQYGVEEAIAAGCDQIVIVTGR
GKSAIEDHFDISYELENTLEKRGKKELLAVSRNVSNMVRLSYVRQKEAMGLGHAVLMARD
LIGDEPFAVILPDDVIDAKVPCLKQMIDQYDKLQGSILATQVVEGPAISSYGVIDGTPLK
DDPRVMEVKGLVEKPKMEEAPSKNAIIGRYVLTPKIFELLEKTPLGAGGELQLTDGIKGL
LQSEKVYGYTFEGKRYDAGDKVGMLTATVDFALKRDDLGPKLREHIQSLGL
NT seq 876 nt NT seq  +upstreamnt  +downstreamnt
atgaagagcagagtacgcaaagcagtttttcccgccgcgggtttcggaacccgctttttg
ccggcaaccaagtccatccccaaggagatgctgccgctggttgataagccgatcattcag
tacggcgtggaagaagccattgccgccggctgcgaccagatcgtgattgtgaccgggcgc
ggcaagtcggccatcgaagatcactttgatatcagctatgagcttgagaacacgctggaa
aagcgcggcaagaaagagctgcttgcggtctctcgcaatgtgtccaatatggtgcgcctc
tcgtatgtgcgccagaaggaagcgatgggcctgggacacgctgtgctgatggcgcgcgat
ctgattggggatgagccgtttgcggtgatcctgcccgatgacgtgattgatgcgaaggtg
ccttgcctgaagcagatgattgaccagtacgacaaactgcagggctcgattctggccacg
caggtggtggaaggaccggccatctcttcgtatggcgtgattgacggcacgccgctcaag
gatgatccgcgggtgatggaagtgaaggggctggtcgagaagccgaagatggaagaggct
ccgtcgaagaatgccattatcggccggtatgtgctgacgcccaagatctttgaactgctc
gagaagacgcctctgggcgcgggcggcgagctgcagttgaccgatggcatcaagggcctg
ctgcagagcgagaaggtctacggctacaccttcgaaggcaagcggtacgatgcgggcgac
aaggtgggcatgctgacagctacggtggattttgcgctgaagcgcgacgatctcggcccg
aagctgcgcgagcatatccagtcgctgggcctgtag

DBGET integrated database retrieval system