KEGG   Acidobacterium capsulatum: ACP_2188Help
Entry
ACP_2188          CDS       T00868                                 

Gene name
hemB
Definition
(GenBank) porphobilinogen synthase
  KO
K01698  porphobilinogen synthase [EC:4.2.1.24]
Organism
aca  Acidobacterium capsulatum
Pathway
aca00860  Porphyrin and chlorophyll metabolism
aca01100  Metabolic pathways
aca01110  Biosynthesis of secondary metabolites
aca01120  Microbial metabolism in diverse environments
Module
aca_M00846  Siroheme biosynthesis, glutamate => siroheme
Brite
KEGG Orthology (KO) [BR:aca00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    ACP_2188 (hemB)
Enzymes [BR:aca01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.24  porphobilinogen synthase
     ACP_2188 (hemB)
Exosome [BR:aca04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   ACP_2188 (hemB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ALAD
Motif
Other DBs
NCBI-ProteinID: ACO34128
UniProt: C1F9M9
Position
complement(2550353..2551342)
Genome map
AA seq 329 aa AA seqDB search
MSYPITRMRRMRRTEPLRALVRETHLEPGALILPLFLCPGEGMRREVSSMPGVFNLSVDE
AVKEAEAAAALGVGGLLLFGLPETKDEQATGAWDDHGIVQQGLRALKQSSASKQLVLIAD
VCLCEYTSHGHCGVVRQQGDEYEIDNDPSLDLLARTAVSLARAGADVVAPSDMMDGRVME
MRDVLDEEGCEQTPILSYASKFASAFYGPFREAADSAPQFGDRRSYQMDGANLREAMREI
ELDLDEGADMILMKPAMPYLDVIRAARERFDVPMGAYQVSGEYSMMQAAFAKGWLDPERA
MMESLLSIRRAGADFIVTYFAQEAAKVLG
NT seq 990 nt NT seq  +upstreamnt  +downstreamnt
atgagctaccccatcacccgcatgcggcggatgcgccgcaccgaaccgctgcgcgccctc
gtgcgcgaaacgcatctggaacccggcgcgctgattctgccgctgtttctctgccctggc
gagggcatgcgccgcgaggtcagctcgatgcccggcgtcttcaatctctcggtcgatgag
gccgtcaaagaggccgaagccgccgccgcgctcggcgtgggagggttgctgctctttggc
cttcccgaaacgaaagacgaacaggccaccggcgcctgggacgaccacggcatcgtgcag
caggggctgcgcgcgctcaagcagagcagcgcctcaaaacagctcgtgctcatcgccgac
gtctgcctctgcgaatacacctcgcacggccactgcggcgtggtgcgccagcagggcgat
gaatatgaaatcgacaacgaccccagcctcgatctgctggcccgcaccgccgtctcgctc
gctcgcgccggggccgatgtcgtcgcccccagcgacatgatggatggccgtgtgatggag
atgcgcgacgtgctcgacgaagagggctgcgagcagacgccgatcctctcctacgcgtcg
aagttcgcctcggccttctacgggccgttccgcgaggccgccgactctgccccgcagttt
ggcgaccgccgcagctaccagatggatggcgcaaacctgcgcgaagccatgcgcgagatt
gagcttgatctcgacgagggcgcggacatgattctcatgaagcccgccatgccttatctc
gacgtgattcgcgcggcgcgcgagcgcttcgatgtgccgatgggtgcctatcaggtctcg
ggcgaatactcgatgatgcaggccgccttcgcgaaagggtggcttgatcccgagcgcgcc
atgatggagtcgctgctctcgattcgccgcgccggcgccgactttatcgtgacctacttc
gcccaggaagcagcgaaggtgctcggctaa

DBGET integrated database retrieval system