KEGG   Acidobacterium capsulatum: ACP_2205Help
Entry
ACP_2205          CDS       T00868                                 

Gene name
rocF
Definition
(GenBank) arginase
  KO
K01476  arginase [EC:3.5.3.1]
Organism
aca  Acidobacterium capsulatum
Pathway
aca00220  Arginine biosynthesis
aca00330  Arginine and proline metabolism
aca01100  Metabolic pathways
aca01110  Biosynthesis of secondary metabolites
aca01130  Biosynthesis of antibiotics
aca01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:aca00001]
 Metabolism
  Amino acid metabolism
   00220 Arginine biosynthesis
    ACP_2205 (rocF)
   00330 Arginine and proline metabolism
    ACP_2205 (rocF)
Enzymes [BR:aca01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.1  arginase
     ACP_2205 (rocF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Arginase
Motif
Other DBs
NCBI-ProteinID: ACO32665
UniProt: C1F9P6
Position
2566480..2567463
Genome map
AA seq 327 aa AA seqDB search
MAAEKAAVAGLTSGPIYSGTQALPPRKIKLIGVPLDMGASRRGVDMGPSAVRVAGLEARL
EALGHQVTDGGNISVAIAETKHSGEQNARYLQEITETCTKAAGMVTKALEQGMTPLVIGG
DHSVAAGSVSGVAEYYRHQNQRIGLLWIDAHGDMNTPETSPSGNVHGMPLAALLGLGPES
LANICGWSPKVLPENTVLIGVRDIDATEKENIKRAGVTEVYTMRDIDERGMRTVMEEALR
AAGRGTAGYHVSLDMDWIDPEDAPGVGTPVRGGATYREAHLAMEIIADHGRMVSFELVEV
NPVIDEHNRTADLAVELICSAFGKKIL
NT seq 984 nt NT seq  +upstreamnt  +downstreamnt
atggccgcggaaaaagccgcggtcgccggactcacctccggccctatctacagcggaacg
caggccctgcccccgcgcaaaatcaagctcatcggtgtgcccctcgatatgggcgcctcg
cgccgcggcgtggacatgggtccctctgccgtgcgtgtggccggcctggaagcgcgcctg
gaggcgctgggccatcaggtgaccgatggcggcaacatcagcgtagccatcgccgaaacc
aagcactccggcgagcagaatgcccgctacctgcaagagatcaccgagacctgcaccaag
gcggccggcatggtcaccaaggcactggaacagggcatgacgccgctggtgattggcggc
gatcactccgtcgcggcgggcagcgtctctggcgtggccgagtactaccgccatcagaac
cagcgcatcggccttctctggattgacgcccacggcgacatgaatacgccggagacctcg
cccagcggcaacgtgcatggcatgccgctcgcggcgctgcttggcctggggccggaatcg
ctggcgaacatctgcggatggagccccaaggtgctgcccgaaaacactgtgctcattggc
gtgcgcgacatcgacgctaccgaaaaagagaacatcaagcgcgccggcgtcaccgaggtc
tacaccatgcgcgacattgacgagcgcggcatgcgcaccgtgatggaagaagccctgcgc
gcggccggacgtggcacggccggctaccatgtctcgctcgacatggactggattgacccg
gaagacgcccccggcgttgggacgcccgtccgtggcggcgcaacgtatcgcgaggcacac
ctggctatggagatcatcgccgaccacggccgcatggtcagctttgagctggtcgaggtg
aatccggtgatcgacgagcacaaccgcaccgctgatttagcggtggagctgatctgctcg
gcgtttgggaagaagattttgtaa

DBGET integrated database retrieval system