KEGG   Acidobacterium capsulatum: ACP_2282Help
Entry
ACP_2282          CDS       T00868                                 

Gene name
glk
Definition
glucokinase (EC:2.7.1.2)
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
aca  Acidobacterium capsulatum
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Class
Metabolism; Overview; Carbon metabolism [PATH:aca01200]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:aca00010]
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:aca00052]
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:aca00500]
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:aca00520]
Metabolism; Biosynthesis of other secondary metabolites; Streptomycin biosynthesis [PATH:aca00521]
Metabolism; Biosynthesis of other secondary metabolites; Butirosin and neomycin biosynthesis
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2650372..2651394
Genome map
AA seq 340 aa AA seqDB search
MILAGDVGGTKVHLALYDFKQGSLQHVRDERFPARDYDGLQVIVRQFLGARTEGDITAAC
FGVPGPVRQGRLKLTNLPWILDSLELSSALDIPHLFLINDLEANGYGIPELRADQIFTLN
PGDRGAVGNRALVSAGTGLGEGVMVWDGRRHVPMASEGGHCDFAARNPLELELLQYLIEK
LQGRVSFERVVSGLGIQNIYRFLRDVKKMEEPAWLRERMEKEDPNAVIGELGESSQNELC
ARTLEMFVAAYGAEAGNMALKVLAVGGMYIGGGIAPKILKTMQNGIFMQAFTDKGRLSEL
LIKTPVHIILESRCALMGAAAYAEQRAAELSGTSVRAASI
NT seq 1023 nt NT seq  +upstreamnt  +downstreamnt
atgattcttgccggcgatgtaggcggcaccaaggttcacttagctctttacgatttcaaa
caaggttcgctgcagcacgttcgggatgagcgcttcccggctcgtgattatgacggcctg
caggtcattgtccgccagttcttgggcgcgcgcaccgagggcgacattaccgcggcctgc
ttcggcgtgcccggaccagtacgtcagggacgtctgaagctcacgaatctaccgtggata
cttgatagcctggagctttccagcgcgcttgatatcccacacctgttcctgatcaatgat
cttgaggcgaatggctacggcatccccgagcttcgggccgatcaaatcttcacgctcaac
ccgggtgatcgcggagctgtcggcaaccgcgcactggtctcggccggcaccggcctcggc
gagggcgtcatggtgtgggatggccgccgtcacgtccccatggcttctgagggtgggcac
tgcgactttgccgcgcgcaatccgctcgaactggagctgctgcagtatctgatcgaaaag
ctgcagggtcgcgtgagctttgagcgcgtggtttcagggcttggcattcagaatatctac
cgttttctgcgcgatgtgaagaaaatggaagaacccgcctggctcagagagcgcatggag
aaggaagatcccaacgccgtcatcggagagctgggcgagagcagccagaatgaactgtgc
gccaggacgctggagatgtttgtggcggcttacggtgcggaagccggcaacatggctctc
aaggtgctggctgtgggcggcatgtacatcggcggcggcattgcgcccaagattctcaag
accatgcagaatggcattttcatgcaggccttcactgacaaggggcgtttgagcgaattg
ctgatcaaaacgccggtgcacatcattcttgagagccgttgcgccctgatgggcgccgcg
gcatatgcagagcagcgcgctgcggagttgagcggcacctcagtacgcgccgcctccatc
tag

DBGET integrated database retrieval system