KEGG   Acidobacterium capsulatum: ACP_2282Help
Entry
ACP_2282          CDS       T00868                                 

Gene name
glk
Definition
glucokinase (EC:2.7.1.2)
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
aca  Acidobacterium capsulatum
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:aca00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    ACP_2282 (glk)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    ACP_2282 (glk)
   00052 Galactose metabolism
    ACP_2282 (glk)
   00500 Starch and sucrose metabolism
    ACP_2282 (glk)
   00520 Amino sugar and nucleotide sugar metabolism
    ACP_2282 (glk)
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    ACP_2282 (glk)
   00524 Butirosin and neomycin biosynthesis
    ACP_2282 (glk)
Enzymes [BR:aca01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     ACP_2282 (glk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2650372..2651394
Genome map
AA seq 340 aa AA seqDB search
MILAGDVGGTKVHLALYDFKQGSLQHVRDERFPARDYDGLQVIVRQFLGARTEGDITAAC
FGVPGPVRQGRLKLTNLPWILDSLELSSALDIPHLFLINDLEANGYGIPELRADQIFTLN
PGDRGAVGNRALVSAGTGLGEGVMVWDGRRHVPMASEGGHCDFAARNPLELELLQYLIEK
LQGRVSFERVVSGLGIQNIYRFLRDVKKMEEPAWLRERMEKEDPNAVIGELGESSQNELC
ARTLEMFVAAYGAEAGNMALKVLAVGGMYIGGGIAPKILKTMQNGIFMQAFTDKGRLSEL
LIKTPVHIILESRCALMGAAAYAEQRAAELSGTSVRAASI
NT seq 1023 nt NT seq  +upstreamnt  +downstreamnt
atgattcttgccggcgatgtaggcggcaccaaggttcacttagctctttacgatttcaaa
caaggttcgctgcagcacgttcgggatgagcgcttcccggctcgtgattatgacggcctg
caggtcattgtccgccagttcttgggcgcgcgcaccgagggcgacattaccgcggcctgc
ttcggcgtgcccggaccagtacgtcagggacgtctgaagctcacgaatctaccgtggata
cttgatagcctggagctttccagcgcgcttgatatcccacacctgttcctgatcaatgat
cttgaggcgaatggctacggcatccccgagcttcgggccgatcaaatcttcacgctcaac
ccgggtgatcgcggagctgtcggcaaccgcgcactggtctcggccggcaccggcctcggc
gagggcgtcatggtgtgggatggccgccgtcacgtccccatggcttctgagggtgggcac
tgcgactttgccgcgcgcaatccgctcgaactggagctgctgcagtatctgatcgaaaag
ctgcagggtcgcgtgagctttgagcgcgtggtttcagggcttggcattcagaatatctac
cgttttctgcgcgatgtgaagaaaatggaagaacccgcctggctcagagagcgcatggag
aaggaagatcccaacgccgtcatcggagagctgggcgagagcagccagaatgaactgtgc
gccaggacgctggagatgtttgtggcggcttacggtgcggaagccggcaacatggctctc
aaggtgctggctgtgggcggcatgtacatcggcggcggcattgcgcccaagattctcaag
accatgcagaatggcattttcatgcaggccttcactgacaaggggcgtttgagcgaattg
ctgatcaaaacgccggtgcacatcattcttgagagccgttgcgccctgatgggcgccgcg
gcatatgcagagcagcgcgctgcggagttgagcggcacctcagtacgcgccgcctccatc
tag

DBGET integrated database retrieval system