KEGG   Acidobacterium capsulatum: ACP_2354Help
Entry
ACP_2354          CDS       T00868                                 

Definition
(RefSeq) dihydrolipoamide acetyltransferase
  KO
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
aca  Acidobacterium capsulatum
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:aca00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    ACP_2354
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    ACP_2354
  Amino acid metabolism
   00310 Lysine degradation
    ACP_2354
Enzymes [BR:aca01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     ACP_2354
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2732923..2734572
Genome map
AA seq 549 aa AA seqDB search
MPTDVVMPQMGESIFEGTITKWLKKPGESVQVDEPLFEISTDKVDAEIPSPVAGTVAEIK
VAEGTTVQINTVVAVINEGGSAAAAASASAPAAAPAPAAAPAPAAPASAPTPAASSSTGA
KHEVVMPQMGESIFEGTITKWLKQVGDKVEVDEPLFEISTDKVDAEIPSPVAGTLSEIKV
QAGNTVQINTVVAVIGGAAGTSAAPAAPAAPAPVAVAPAAAPSAPAAEEDYADSAEHVRS
SPLVRKIARENNVDLRKVSGTGAGGRITKDDIQGYLEGKPAAAPAAAAPAPVAAAPAPAA
APRATAPAPAAAVPQPGELVPMSKMRTIIAQRMIDSKHTSAHVHTVFKIDFTRIVKLREK
EKNKYEQRNGVKLTYMPFITRAVVATLRKMPIMHAQMKGDAILYPANINIGIAVALDWGL
IVPVIKQAEEKSFLGIARGIADLAERARGKKLKPDEVGSGTFTITNPGIFGEQFGTPIIN
QPESAILGVGGLFKEPAVITDKDGTDSIAIRHMIHLTLGFDHRIIDGADAGKFMAEVKKY
LENWTEDIG
NT seq 1650 nt NT seq  +upstreamnt  +downstreamnt
atgccgaccgatgtagtcatgccccagatgggcgaatcgatctttgaaggcaccatcacc
aaatggctcaagaaaccgggcgagagcgtccaggtagacgagcccctcttcgagatttcc
accgacaaggtcgatgcggagattccttcgcctgtggcaggcacggtcgccgaaatcaag
gtcgccgaaggcaccaccgttcaaatcaacaccgtcgtcgccgtcatcaatgagggcggc
agtgcggcagcggccgcttcagcctcggctcccgcggcggccccagctcccgcagcggct
ccggcgccagcagccccggcttcggccccaactcctgcggccagttccagcacgggcgca
aagcatgaagtggtgatgccgcagatgggcgagtccatctttgagggcaccatcaccaag
tggctcaagcaggtgggcgacaaggtcgaagtggacgagcctctctttgagatctccacc
gacaaggtagacgctgagattccctcgcctgtggcgggcacactctctgaaatcaaggtg
caggccggcaacacggtgcagatcaacacggtggtcgccgtcattggcggcgcagccggt
acatccgctgctcccgctgctcctgccgccccggctccggtcgcagttgctccggcggcc
gcgccctccgctccggctgcggaagaggactacgccgacagcgctgagcacgtgcgctct
tcgccgctggtgcgcaagattgcccgcgaaaacaatgtggacctgcgcaaggtgtctggc
accggtgccggtggtcgcatcaccaaggacgatattcagggctacctcgaaggcaagccc
gccgctgctccggctgctgccgccccggcccccgtggccgctgcgcctgctccggctgcc
gcaccgcgcgctactgctcccgcgcctgccgctgccgttccgcagcctggtgagctggtc
cccatgtccaagatgcgcaccatcatcgcgcagcgcatgatcgactccaagcacaccagc
gcgcacgttcacacggtcttcaagatcgacttcacccgcatcgtcaagctgcgtgagaag
gaaaagaacaagtatgagcagcgcaacggcgtcaaactgacctacatgccgttcatcacg
cgcgccgtggtggccacgctgcgcaaaatgcccatcatgcacgcacagatgaagggcgac
gccatcctctacccggccaacatcaacatcggcatcgccgtggctctcgactgggggctg
attgtgccggtcatcaagcaggctgaggagaagagcttcctgggcattgcccgtggcatc
gcggacctcgccgagcgcgcgcgcggcaagaagctgaagccggacgaagtcggttcgggc
accttcacgatcaccaacccgggcatctttggcgagcagtttggcacgccgatcatcaat
cagcccgagagcgcgattctcggtgtgggcggcctcttcaaggagccggccgtcatcacc
gacaaggacggcacggactcgatcgccatccgccacatgattcacctcacgctcggcttt
gatcaccgcatcattgatggcgccgacgcgggcaagttcatggccgaggtcaagaagtac
ctcgaaaactggaccgaagacatcggctaa

DBGET integrated database retrieval system