KEGG   Acidobacterium capsulatum: ACP_2434Help
Entry
ACP_2434          CDS       T00868                                 

Gene name
hemG1
Definition
protoporphyrinogen oxidase (EC:1.3.3.4)
Orthology
K00231  
oxygen-dependent protoporphyrinogen oxidase [EC:1.3.3.4]
Organism
aca  Acidobacterium capsulatum
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:aca00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    ACP_2434 (hemG1)
Enzymes [BR:aca01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.3  With oxygen as acceptor
    1.3.3.4  protoporphyrinogen oxidase
     ACP_2434 (hemG1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2822217..2823626
Genome map
AA seq 469 aa AA seqDB search
MKHIAVIGGGISGLTAAWQLTQLDQSCTLFEASARVGGIVETERRDGFVIECGPDSWVAE
KPWARELAIELGLEDEIIASNDFQRRTWLLRDGQLLPMPDGMRMMVPTRLDALEGSPLFS
QEAIRAYAAEPSRAEGLRASALPEGQDESVASFVRRHFGDEVTRTIAAPLLAGVFGGDVE
QLSVRSVMAPFVKMEQEHGSLIAALNARPPKPGHGGTSIFGSLRSGLGTLAEKMSEALPT
ASVHFETPVQALAREGGQWRVSTTQGSGLFDAVLLATPANATRALLARLDAAAAALLPVE
ASSAIVVALAYDRAAARHMRVPEGFGYLVPPPQAGQGPSAESLLACTFVDQKFPHRAPDG
CVLLRAFFGGDAAERLLHAPESELITRAEAQLAVALGPLPAPAFSLVRRWPLSLPQYATG
HLDRMRELEARVAQLPGLTLLGNAYHGVGLPDLIRQARSAARALVAPEA
NT seq 1410 nt NT seq  +upstreamnt  +downstreamnt
atgaagcacattgcggtcatcggaggcggcatcagcggtctcaccgccgcctggcagctc
acgcaactggatcaatcctgcaccctctttgaggcaagcgcgcgggtgggcggcattgtg
gaaacagagcggcgcgacggctttgtgatcgagtgcggccccgattcctgggtggctgag
aagccctgggcgcgcgaactggcgattgagctgggtctggaagacgaaatcatcgcgtcg
aacgattttcagcgccgcacctggctgctgcgtgatggccaactgctgcccatgcccgat
ggcatgcgcatgatggtgcccacgcggctcgatgcgctcgaaggctccccgctgttttct
caagaggcgatccgcgcctatgccgccgaaccctcccgcgcggagggactgcgcgcgtcg
gcgctgccggaggggcaggatgagtccgtggccagcttcgtgcgccgccactttggcgat
gaggttacccgcaccatcgcggcgcccctgctggctggggtcttcggcggcgatgtggag
cagttgagcgtccgctcggtgatggcacccttcgtcaagatggagcaggagcacggcagc
ctgatcgctgctctcaacgcgcgcccgcctaagccgggccatggtggcacgtctattttc
ggctcgctgcgctcggggttgggcacactggctgaaaaaatgtctgaggctctgcctacg
gccagcgtccattttgaaactccggtccaagccctggcacgcgagggaggccagtggcgg
gtgtccaccacgcaagggagtggcctctttgacgcggtgttgctggccacgcctgcgaat
gctacccgcgcgctgctggcccggctcgatgcggctgccgccgcgctgctgccggtagaa
gccagctccgccatcgtcgtggcgctggcctatgatcgggctgcggcccggcatatgcga
gttccagagggatttggttacctcgtgccgccgccgcaggctgggcagggccccagcgcc
gaatcgctgctggcctgcacctttgtggatcagaagttcccgcatcgcgcccccgatggc
tgcgtgctgctgcgcgccttctttggcggggatgccgcggagcgtcttctgcatgcgccg
gagagtgaattgatcacccgcgccgaggcgcaattggccgtggcgctggggccgctgccc
gcgcccgcgttttctctggtgcgccgctggccgctttcgctgccgcagtatgcgaccggc
catctggaccgcatgcgggagcttgaagcccgcgttgcgcagctcccgggtctcacgctg
ctgggcaacgcctatcacggtgtggggctgccggatctgattcgccaggcgcgcagtgct
gcccgcgcgctggttgcgcccgaagcgtag

DBGET integrated database retrieval system