KEGG   Acidobacterium capsulatum: ACP_2722Help
Entry
ACP_2722          CDS       T00868                                 

Definition
di-heme cytochrome c peroxidase family protein
Orthology
K00428  
cytochrome c peroxidase [EC:1.11.1.5]
Organism
aca  Acidobacterium capsulatum
Brite
Enzymes [BR:aca01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.5  cytochrome-c peroxidase
     ACP_2722
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3161795..3163105)
Genome map
AA seq 436 aa AA seqDB search
MRLTFSALFLTALLSAGTLCLAGSTRLSTQAIRHSEMSAAARLGKKIFFDKSLSGSGKMA
CATCHDPRFAYGPPNASAVQYGGPDLKTPGYRAAPSLRYVLNYVPHWSDVRASNPIEQLT
ETENVPTGGYTWDGRYNSLHAQALLPLFSPAEMDNRNAATLAHKLSQSDYAAEFRSVFGA
RIFSRPAKAVQDAAMALQQFELEDKSFHPYSSKYDRWLDGKASLTPQELHGKELFDNPNS
GNCASCHLDEVGANGRHPIFTDFQFEALGVPRNDEIPWNSNPHYYDLGLCGPFRKDKASH
DPANCGLFRTPSLRNVAIRKVFFHNGRFHTLRQALLFYVERDTDPGKWYPAGPNGKVEKF
NDLPIKNRANVDTTDAPLNRSLGEKPVWNAQQIDDVIAFLKTLTDQDVVKRLPPPPHSAN
ASLHQARRGSAKDSPR
NT seq 1311 nt NT seq  +upstreamnt  +downstreamnt
atgcgactcactttttcagccctgtttttgaccgccttgctctcagcgggaaccttatgt
cttgccggcagcaccagactctcaactcaggctatccgtcacagcgagatgagcgctgcc
gcccgtcttgggaaaaagatcttctttgacaagtcgctttccggatcaggaaaaatggcc
tgcgcgacttgccatgatccgcgcttcgcctacggcccacccaatgcaagtgcggtgcaa
tatggtggaccagacctcaagactcccggctaccgtgcggccccttccctgcgttatgtc
ctcaactatgtgccgcattggtccgatgtgcgagccagcaatccaatcgagcaactgact
gagacggagaatgttcctaccggtggttacacctgggacgggcgctacaactcgctgcac
gcccaggccctgctacctcttttctcccctgcggagatggacaatcgcaacgccgccaca
ctcgctcacaagctcagtcaatcagactacgccgcggaatttcgctccgtctttggagcc
cgcatcttttcccgccctgccaaagctgtgcaggatgcggccatggctctccagcagttt
gagctggaggataagagctttcatccctacagcagcaagtatgatcgttggctcgacgga
aaagcctcgcttacaccgcaggaactgcacggcaaagaattattcgataaccccaacagc
ggcaactgcgcttcctgtcatctggatgaagttggggcaaatggcaggcatccgattttt
actgattttcagtttgaagcgctgggcgtgccgcgcaatgatgaaattccctggaacagt
aatccgcactactacgacctgggcctctgcggtccgtttcgcaaagataaagcctctcat
gatccggcaaactgcgggctctttcgcaccccttccctgcgcaacgtcgcaatcaggaaa
gtcttctttcacaatgggcgttttcacacgttgcgccaggcgctgctgttctatgtggaa
agagatacggatcccggcaagtggtatccagccggcccgaatggaaaagtagagaagttt
aacgatctgccgatcaaaaaccgcgccaatgtcgacaccacggacgctcctctcaaccgc
tctctcggggaaaagcccgtgtggaatgcacagcaaatcgatgatgtcatcgcatttctt
aaaacgctgaccgatcaggacgtcgtaaagcgcctgcctcctccaccgcattccgcaaat
gcttccttacaccaggcgcgtcgcggctcagcgaaggattcccctcgctga

DBGET integrated database retrieval system