KEGG   Acidobacterium capsulatum: ACP_2811Help
Entry
ACP_2811          CDS       T00868                                 

Gene name
acsA
Definition
(GenBank) acetate--CoA ligase
  KO
K01895  acetyl-CoA synthetase [EC:6.2.1.1]
Organism
aca  Acidobacterium capsulatum
Pathway
aca00010  Glycolysis / Gluconeogenesis
aca00620  Pyruvate metabolism
aca00640  Propanoate metabolism
aca00680  Methane metabolism
aca01100  Metabolic pathways
aca01110  Biosynthesis of secondary metabolites
aca01120  Microbial metabolism in diverse environments
aca01130  Biosynthesis of antibiotics
aca01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:aca00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    ACP_2811 (acsA)
   00620 Pyruvate metabolism
    ACP_2811 (acsA)
   00640 Propanoate metabolism
    ACP_2811 (acsA)
  Energy metabolism
   00680 Methane metabolism
    ACP_2811 (acsA)
Enzymes [BR:aca01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     ACP_2811 (acsA)
Lipid biosynthesis proteins [BR:aca01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   ACP_2811 (acsA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding AMP-binding_C ACAS_N
Motif
Other DBs
NCBI-ProteinID: ACO31372
UniProt: C1F3B7
Position
complement(3278087..3280048)
Genome map
AA seq 653 aa AA seqDB search
MSIDTSDESLDSTLREDRIFPPPEEFSRAAYVKSLAEYEALYQRSVEDPEGFWGDVAADL
HWFSRWNNVLEGEVPWVKWFAGGKLNLCYNCVDRHVHEGRGDKVAILWEGEPGDVRKLTF
SDLHLEVQRFANALKSLGIRKGDCVAIYMGMTPELAVAVLACARIGAVHSVIFGGFASNA
IVDRVNDAHAVAVITQDTAWRRGGEVKLKAAVDEALPHCPTVRNVVVCRRTGSPVTMQGG
RDHWWHDLVKDVPAQCPAEHQDSEDPLYILYTSGTTGKPKGLVHTTGGYAVQTYLTSKLI
FDLRPDDVFWCTADIGWVTGHSYVLYGALQNGVTTVMYEGAPTYPQPDRFWKMIDDHKVT
IFYTAPTAIRAFMKQGDEHPMRHKLDSLRLLGTVGEPINPEAWMWYRKVIGRDRCPIVDT
WWQTETGAIMLSPLPGAIPTKPGSATRPFPGIVPEVVTKEGKPVPAGQGGLLVIRKPWPS
MARTIFNDPERYVKTYWSDIPGSYFTGDGARMDADGYYWLMGRVDDVINVSGHRLGTMEI
ESALVAHPKVAEAAVVGRPHDLKGQAISAFVTLEEGHEPSSELKEELRAWVAKEIGALAR
PDDMRFTDSLPKTRSGKIMRRLLRELATHGEFKGDTTTLEDFTVLAKLREQDE
NT seq 1962 nt NT seq  +upstreamnt  +downstreamnt
gtgagcatcgacacttccgatgaatcgctcgattccactctgcgcgaagaccgcatcttt
ccaccgccggaggaattttcccgcgcggcctacgtcaagagcctcgcggaatatgaagcg
ctttaccagcgttcggtggaagatcccgagggattctggggagacgtggccgccgatctg
cactggttttcccgctggaacaacgtgctcgaaggcgaagtgccgtgggtgaagtggttt
gccggcggcaagctgaatctctgctacaactgcgtggaccggcatgtgcatgagggcagg
ggcgataaggtcgccattctgtgggaaggcgagccgggcgatgtgcgcaagctcacattc
agcgatctgcacctggaggtgcagcgctttgccaacgcgctcaaatccctgggcattcgc
aagggagactgcgttgccatctacatgggcatgacgcccgagctggcggttgcggtgctg
gcctgcgcccgcattggcgcggtgcattcggtcatctttggcggatttgcctcgaacgcc
atcgtggatcgcgtcaacgacgcgcatgccgtcgccgtgatcacgcaggacacggcatgg
cggcgcgggggcgaagtcaagctaaaggccgccgtggatgaagcgctgccccactgcccc
actgtgcgcaatgtggtggtatgccggcgcacgggcagccctgtcaccatgcagggcggg
cgcgatcactggtggcatgacctggtgaaggacgtgccggcacaatgcccggccgagcat
caggactcagaagatccgctctacattctttacacctcgggcaccacgggcaaacccaag
ggtctggtgcatacgaccggcggctatgccgtgcagacctacctgaccagcaagctgatc
tttgatctgcgtccggatgatgtgttctggtgcacggccgatatcggctgggtgacgggc
cactcctacgtgctctatggggcactgcagaatggcgtgacgacggtgatgtatgagggt
gcgccgacttatccgcagcccgaccgcttctggaagatgatcgacgaccacaaggtcacg
atcttttacaccgcccccacggcgattcgcgccttcatgaagcagggcgacgagcacccc
atgcggcacaagctcgacagcctgcggctgctgggcaccgtcggcgagccgatcaatccg
gaagcgtggatgtggtaccgcaaggtgatcggccgcgaccgctgcccgattgtggatacg
tggtggcagaccgagaccggcgccatcatgctctcgcccttgccgggcgctatccccacc
aagccgggttcggccacgcggccttttcctggaattgtgccggaagtggttacaaaagaa
ggcaaacctgttcccgcggggcagggcggcctgctggtgattcgcaagccgtggccctcg
atggcccgcaccatcttcaatgatcctgagcgctacgtgaagacgtactggtccgatatt
cccggctcctacttcaccggcgacggcgcgcgtatggatgcggacggctactactggctg
atgggccgcgtcgatgacgtcatcaacgtcagcggccaccggctggggacgatggaaatc
gagtccgcgctggtcgcgcaccccaaggtggccgaggcggctgtcgtggggcggccgcat
gatctgaaggggcaggcgatctccgcctttgtgacgctcgaagagggccacgagccctcc
tcggaactcaaggaagagctgcgtgcctgggtcgccaaggagattggcgcgctggcccgg
cccgacgatatgcgctttaccgattcgctgccgaagacccgctccggcaagatcatgcgg
cgtctgctgcgcgagctggcaacgcatggcgagttcaagggcgacaccaccacgctcgaa
gacttcaccgtgctggccaagctgcgcgagcaggatgagtag

DBGET integrated database retrieval system