KEGG   Acidobacterium capsulatum: ACP_3137Help
Entry
ACP_3137          CDS       T00868                                 

Definition
isochorismatase family protein
Orthology
K08281  
nicotinamidase/pyrazinamidase [EC:3.5.1.19 3.5.1.-]
Organism
aca  Acidobacterium capsulatum
Pathway
Nicotinate and nicotinamide metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:aca00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00760 Nicotinate and nicotinamide metabolism
    ACP_3137
Enzymes [BR:aca01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.19  nicotinamidase
     ACP_3137
    3.5.1.-  
     ACP_3137
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3625253..3625873
Genome map
AA seq 206 aa AA seqDB search
MQIRADDVLIVVDVQNDFCPGGALAVPEGDAVIPAILEIAPKFEHVVLTQDWHPAGHGSF
ASSHQGRHPLETVTMAYGEQTLWPDHCVQGTWGAELHAELKLPQADLILRKGLRRDVDSY
SAFFENDRVTPTGLEEYLRERGLRRAFFAGLAYDFCVGYSALDARRLGREAVVLREACRA
IDARGSAAAMERRLREAGVVEMPSAL
NT seq 621 nt NT seq  +upstreamnt  +downstreamnt
atgcagatacgcgcggacgatgtgctgattgtggtggatgtgcagaacgacttctgcccg
ggcggcgcgctggccgtgccggagggcgacgcggtgattccggcgattctggagattgcg
cccaagtttgagcatgtggtgctgacgcaggactggcatccggcggggcatgggtcattt
gcgagtagccatcagggacggcatccactcgaaacggtgaccatggcttatggcgagcag
acgctgtggcccgaccattgcgtgcagggcacgtggggtgccgagctgcacgcggagctg
aagctgccgcaggcggatctgattttgcgcaaagggttgcggcgggatgtggattcgtat
tcggcgttttttgagaatgaccgcgtgacgccgaccggccttgaagaatacctgcgggag
cgcgggctgaggcgtgcgttttttgcggggctggcgtatgacttttgcgtggggtattcc
gcgctggatgcgcggcggctggggcgcgaagcggtggtgctgcgcgaggcctgccgcgcg
attgatgcacgaggctcggcggcggcgatggagcggcggctgcgcgaggccggggtggtg
gagatgccatcggccctctga

DBGET integrated database retrieval system