KEGG   Acidobacterium capsulatum: ACP_3389Help
Entry
ACP_3389          CDS       T00868                                 

Gene name
thrC2
Definition
threonine synthase (EC:4.2.3.1)
Orthology
K01733  
threonine synthase [EC:4.2.3.1]
Organism
aca  Acidobacterium capsulatum
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:aca01230]
Metabolism; Amino acid metabolism; Glycine, serine and threonine metabolism [PATH:aca00260]
Metabolism; Metabolism of cofactors and vitamins; Vitamin B6 metabolism [PATH:aca00750]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3934404..3935675
Genome map
AA seq 423 aa AA seqDB search
MAVAFELRCRECGRSYGNAPLSICEDCFTPLEVFCDLEAARGEFTREKIAAGPTSMWRYK
ALLPVAEDFEPVTPAGWTPLLKAPNLGRRIGANNLYIKNDAVCLPTLSFKDRVVAVALAS
AKAFGFDTVGCSSTGNLANAVAAQAARMGLKTFILVPADLEAAKILNTQVYGANLVRIDG
NYDHVNRLCSQIADRYHWGFVNVNLRPYYAEGSKSVGFEIAEQLGWRLPDNVVVPMAGGS
LIRKIHKAFRELVALGLVEDKHVRFFGAQATGCSPIAAAVKAGRTEIEPQRPSTIARSLA
IGNPADGRYAAALIQETGGYAEDVSDVELVSAIQELAETEGVFTETAGGVTTAVTARLYA
HGRIHPDELTVTCITGNGLKTTDALQGSYELEQAVRPRLADFEAYVEEKKFQHELVLEGS
YAR
NT seq 1272 nt NT seq  +upstreamnt  +downstreamnt
atggctgtggcttttgaacttcgttgtcgtgagtgcggacgatcctatggaaacgctccg
ctgtcgatttgcgaggactgttttacgccgctggaggtattctgcgatctcgaagcggcg
cgtggcgagtttacgcgcgagaagattgcggctggccccacgagcatgtggcgctacaag
gcgctgctgccggtcgcggaagattttgagccggtcacgcccgccggctggacgcctctg
ctgaaggctccgaaccttggccgccgcatcggcgccaacaatctctacatcaagaacgac
gccgtgtgcctgcccacgctgagcttcaaagatcgcgtggtcgccgtggctctggccagc
gccaaggcctttggattcgatacggtcggctgctcctcgaccggcaacctcgccaatgcc
gtagccgcgcaggccgcgcgcatgggactcaagaccttcattctcgtcccggccgatctt
gaggccgcaaagattctcaacacgcaggtctacggcgcaaatctggtgcgcatcgacggc
aactatgaccacgtgaaccgtctctgctcgcagattgccgaccgctaccactggggcttt
gtgaatgtaaatctgcgcccctactatgccgaaggctccaagagcgtgggctttgaaatc
gccgaacagcttggctggcgcttgcctgacaacgtggtggtccccatggccggcggctcg
ctgatccgcaagattcacaaggcgtttcgtgagctggtcgcgctcggcctggtcgaagac
aagcatgtgcgcttctttggcgcgcaggccaccggatgctcgcccattgctgccgctgtg
aaggcgggccgcactgagattgagccgcagcgcccttcgacgattgcgcgttcgctcgcg
atcggcaacccggccgatggccgctacgccgccgcgctcattcaggagacgggcggttat
gccgaagatgtgtccgacgtggagctggtctccgcaattcaggagctggccgaaaccgaa
ggcgtcttcaccgagacggccggcggcgtgaccacggcggtgaccgcgcggctctatgcg
catggccgcattcatcctgacgagctgaccgtcacctgcatcaccggcaacggcctcaag
accaccgacgcactgcagggctcctatgagctggagcaggcggtgcgtccgcgcctggcc
gactttgaggcttacgtcgaagagaaaaaattccagcatgagctggtactggaaggaagc
tatgcccgttag

DBGET integrated database retrieval system