KEGG   Acidobacterium capsulatum: ACP_3493Help
Entry
ACP_3493          CDS       T00868                                 

Gene name
adh
Definition
zinc-containing alcohol dehydrogenase (EC:1.1.1.1)
Orthology
K13953  
alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
aca  Acidobacterium capsulatum
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:aca00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    ACP_3493 (adh)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    ACP_3493 (adh)
  Lipid metabolism
   00071 Fatty acid degradation
    ACP_3493 (adh)
  Amino acid metabolism
   00350 Tyrosine metabolism
    ACP_3493 (adh)
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    ACP_3493 (adh)
   00626 Naphthalene degradation
    ACP_3493 (adh)
Enzymes [BR:aca01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     ACP_3493 (adh)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4056621..4057637
Genome map
AA seq 338 aa AA seqDB search
MKAAVVREFGKPLTIEERAIPEPGPEEIQVKIEACGVCHTDLHAAHGDWPVKPNPPFVPG
HEGVGFVSGVGKSVKHIKEGDRVGIPWLYSACGVCEHCLAGWETLCEKQQNGGYSVDGGF
AQYALADPNYVAHIPANVDFYEIAPVVCAGVTVYKGLKMTEAQPGEWVVISGIGGLGHLA
VQYAKAMGMHVAAVDVAPDKLALAKKLGATLTINAKEQDPVAYLKKEIGGAHGVLVTAVS
PKAFEQALGMVRRGGTVALNGLPPGSFPLPIFDMVLNGITLRGSIVGTRLDMSEALSFAA
EGLVHATIAKARLEEINAVFAKMEAGGIDGRIVLDVNT
NT seq 1017 nt NT seq  +upstreamnt  +downstreamnt
atgaaagctgcggtagtgcgcgagtttggcaagccattgacgattgaagagagggcgatt
cccgaaccgggtccggaagagattcaagtgaagatcgaggcctgcggcgtttgccacacc
gacctgcatgcagcccatggcgactggcctgtgaagccgaatccaccttttgttcccggc
cacgaaggcgttggatttgtctctggcgtgggcaagtcggtcaagcacattaaagaggga
gaccgcgtgggcattccctggctctactccgcctgcggcgtatgcgagcactgccttgcc
ggatgggaaacactctgcgagaagcagcagaacggcggctattccgtcgatggaggcttt
gcgcagtatgctctcgctgaccccaattacgtcgctcacattccagccaatgtcgatttc
tatgagatcgcgccggtggtctgcgccggggtcaccgtctacaagggactcaagatgacc
gaagcccagccgggcgagtgggtcgtcatttcaggcatcggcggcctcgggcatctggcc
gtgcaatatgccaaagcgatgggcatgcatgtggcggcggtcgatgtggccccggacaaa
ctggctctcgccaaaaagctgggcgcaaccctcacgataaatgccaaagaacaagacccc
gtggcctacctcaaaaaagaaatcggcggcgcgcacggtgtactcgtcaccgctgtttct
cccaaagcctttgagcaggctcttggaatggtgcgacggggcggaactgtggcattgaat
ggattgccgccgggttcgtttcctctgcccatctttgacatggtgctcaacggcatcact
ctgcgcggctctatcgtcggcacacgtttggatatgagcgaggcgctttcctttgcagct
gaagggctcgtgcatgccaccatcgccaaagccaggctcgaagagatcaatgccgtattc
gcaaagatggaagccggcggcatcgacggacgaattgttcttgacgtcaacacgtag

DBGET integrated database retrieval system