KEGG   Acanthamoeba castellanii: ACA1_013390Help
Entry
ACA1_013390       CDS       T02667                                 

Definition
glucan (1,4alpha-), branching enzyme 1, putative
Orthology
K00700  
1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
acan  Acanthamoeba castellanii
Pathway
Starch and sucrose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:acan00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    ACA1_013390
Enzymes [BR:acan01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.18  1,4-alpha-glucan branching enzyme
     ACA1_013390
Exosome [BR:acan04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   ACA1_013390
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
Unknown
AA seq 692 aa AA seqDB search
MDVEKKSNAQQLASTGANVPEKMETETKKKDLMKLVVDDPWLEPHNDKIKWRYERFEALK
NEIEKVEGSLDAFSSAYQDKFGFIKRPDGVTYREWAPGAAEVTLTGDFNGWNRDTHKMQK
DEHGVWSVFVPNAPDGIAIPHGSKVKAVVGYRDQHGQYKREDRIPVWAKRVVEHFHDGQR
IFDAVHWDPPQQYQWKNKAPSKPASLHIYETHVGMSSREPRVSSYAEFRQHLLPYIKETG
YTAIQLMAVMEHSYYPSFGYQVTNFFAVSSRFGTPEELKELSTSTSHASPNVGDGLNNWD
GTEYHYFHSGGKGNHSGWGTRLFDYGKWEVLRFLMSNLKWFVDEYKFDGFRFDGVTSMLY
VHHGNYTSNWDYDTYFGGDVDEDSVRYLQLANYMLHKNYPGIVTIAEDVSGMAGLCRPVE
DGGVGFDYRLGMGLPDMWAKMCTEDEDWSMQGIVWDLTNRRWNEATVAYCESHDQSLQGG
KTIAFRLMDKEMYWHMSTLQPLHMTIDRGIALHKMIRLITLALGGEAYLAFMGNEWGHPE
WVDFPRPGNNNSYDKCRRRWDLLEDKLLRYQHMYNLDKAMLRLANDHPFLNTREYVIVKH
EDNKLITFERGEFYWIFNFHPTKSFPDYRVGVTQPGKYEIMLDTDAAEYGGHSRMQAGVS
FFTEPKAWDDRPNSMLIYAPCRAALVLKRAQE
NT seq 2079 nt NT seq  +upstreamnt  +downstreamnt
atggacgtagagaagaagagcaacgcacagcagctggcctccactggcgcgaatgtccca
gaaaagatggaaacggaaacgaagaagaaggatcttatgaagctggtggtggacgacccg
tggctggagccccacaacgacaagatcaagtggcgctacgagcgcttcgaggccctgaag
aacgagattgagaaggtcgagggcagcctcgacgccttcagctcggcctaccaggacaag
tttggcttcatcaagcgtcccgacggcgtcacctaccgcgagtgggctcccggcgctgcc
gaggtcaccctcacgggcgacttcaatggctggaacagagacacgcacaagatgcagaag
gacgagcacggcgtctggtccgtctttgtgcccaacgcgcccgatgggatcgccattccc
cacggcagcaaagtcaaggcggttgtcggctaccgcgatcagcacggtcaatacaaacgc
gaggaccgcatccctgtgtgggccaagcgcgtcgtcgagcacttccacgacggccagcga
atctttgatgccgtgcactgggatcctccgcagcagtaccagtggaagaacaaggccccg
tcgaagcccgccagtctccacatctacgagacccacgttggcatgtccagccgcgagcct
cgcgtgtcgtcctacgccgagttcaggcagcacctgctgccctacatcaaggagacgggc
tacaccgccattcagctgatggccgtgatggagcactcctactacccctcgttcggctac
caggtcaccaatttcttcgccgtctcgtctcgcttcggcacgcccgaggagctcaaggag
ctgtctacctcgacctcccacgcctcccccaacgtgggcgacggtttgaacaactgggac
ggcaccgagtaccactacttccactccggcggaaagggcaaccactctggctggggcacg
cgcctgttcgattacggcaagtgggaagtgctgcgcttcctcatgagcaacctcaagtgg
ttcgtcgacgagtacaagttcgacggcttccgattcgatggcgtgacgtcgatgttgtac
gtccaccacggtaactacacctccaactgggactacgacacctacttcggcggtgacgtc
gacgaagactccgttcgctacctgcagctggccaactacatgcttcacaagaactacccc
ggcatcgtcacgatcgccgaagacgtgtcgggaatggctgggctctgccgtccggtggag
gacggaggcgtgggcttcgactacaggctcggcatgggccttcccgacatgtgggccaag
atgtgcaccgaagacgaggactggagcatgcaaggcatcgtgtgggacctgaccaaccgc
aggtggaatgaggcgaccgtcgcctattgcgagtcgcacgatcagtccctgcagggaggc
aagacgatcgccttccgtctcatggacaaggagatgtactggcacatgtccacactgcag
cctctccacatgaccatcgatcgcggcatcgctctccacaagatgatccgtttgattacg
ctggccctcggcggtgaggcctacctcgcgttcatgggcaacgagtggggccaccccgag
tgggtcgacttcccgcgcccgggcaacaacaacagctacgacaagtgcaggcgcaggtgg
gacctcctcgaggacaagctactcagatatcagcacatgtacaacctcgacaaggccatg
ctgcgcctcgccaacgaccaccccttcctcaacaccagagagtatgtgattgtgaagcac
gaggacaacaagctgatcaccttcgagcgcggcgagttctactggatcttcaacttccac
ccgaccaagtcgttcccggactatcgcgtgggcgtgacccagccgggcaagtacgagatc
atgctcgacaccgacgccgccgagtacggcggccacagccgcatgcaggccggcgtgtcc
ttcttcaccgagcccaaggcctgggacgacaggcccaactccatgctcatctatgctccc
tgccgagcggcgttggtcctgaagcgcgcccaggagtga

DBGET integrated database retrieval system