KEGG   Acanthamoeba castellanii: ACA1_039660Help
Entry
ACA1_039660       CDS       T02667                                 

Definition
NAD+ dependent glutamate dehydrogenase
Orthology
K15371  
glutamate dehydrogenase [EC:1.4.1.2]
Organism
acan  Acanthamoeba castellanii
Pathway
Alanine, aspartate and glutamate metabolism
Arginine and proline metabolism
Taurine and hypotaurine metabolism
Nitrogen metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:acan00001]
 Metabolism
  Energy metabolism
   00910 Nitrogen metabolism
    ACA1_039660
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    ACA1_039660
   00330 Arginine and proline metabolism
    ACA1_039660
  Metabolism of other amino acids
   00430 Taurine and hypotaurine metabolism
    ACA1_039660
Enzymes [BR:acan01000]
 1. Oxidoreductases
  1.4  Acting on the CH-NH2 group of donors
   1.4.1  With NAD+ or NADP+ as acceptor
    1.4.1.2  glutamate dehydrogenase
     ACA1_039660
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
Unknown
AA seq 1023 aa AA seqDB search
MQSQVTTQKAEVLALLRKDGKINADLVEGEVDWFFDKLGMVDNYFTSQSAEVIAKHISAI
YANKMLSSAESGKVKINIQQEHKDGAIFACNSVPGSQTSPAVAIERRLDERYLALQDDGS
SYRVQVYRSSGFVSSEQQQNLRLYVVNKANYGSDEADPAQLRDELDINKIGDRDFLVKAS
ASTKEIYQNILRKAARIPGPVIESYDAEVGEKRIVICYRRGTTTRFFGALTDLYHYHGFV
ARKKFVEQFANGFLIVCLYLTTPASQPAQDAADVNARMRLFEKEANLIYILPSSRMASLL
QAGELSEEECVYAHAAWKFAAHFINRMGSEYHALRKALDMRDERHAGLMAALKRRLVNAT
FTEHSIGDVIMANPAMVKLLYRDFARLHNPADADAQASLQLGADALAARRDEVLAAIKRH
AAASEQDQEIFGMFLTFNRHVVKTNFYKVDKVALSFRLSPEFLDDQEYPQRPFGIFYIIG
DEFRGFHVRFSDVARGGVRIVRSRDTESYATNARHMFEECYGLANTQERKNKDIPEGGSK
GVILLDLAKAAHGQPHKPEQAENAFKKYVDSILDILLSSQETRREQAIVDHYKTEEILFL
GPDEGTADVMDWASQRAKERGASFWKAFTTGKSRSLGGIPHDMYGMTTRSIHQYVVGILA
KLGIDEADVTKFQTGGPDGDLGSNEIKISRDKTIGIVDGSGVLYDPQGIDREELRRLADA
RLMVREFDRARLSAGGFLVDVNDREVTLPDGTVVDNGLNFRNEFHLNPLSSATLFVPCGG
RPEAVNISNVDKFFHHRRSTATTAGGAPERVPRFKYIVEGANLFFTQEARLVLEEAGVVI
FKDASANKGGVTSSSLEVLAALALKDDEFLAHMTVQKSADTGDEVVPDFYRRYIENVHQI
IERNAALEFQAVWDANKRTGLPRSVIADLVSTKINGLNVQIQNSNLWTNQAFKNLVLAEA
CPPVLLELVGGVAGLCQRVPENYLRAIFGAYLGSRYIYRYGLETREFDFFDFVQPYFDRI
AAQ
NT seq 3072 nt NT seq  +upstreamnt  +downstreamnt
atgcagtcccaggtgaccacacagaaggcggaggtgctcgcactcctccgcaaggacggc
aagatcaacgccgacctcgtcgaaggcgaggtcgattggttcttcgataaactgggtatg
gtggacaactacttcacgagccagtcggccgaggtaatcgccaagcacatctcggccatc
tacgccaacaagatgctctcctcggccgagagtggcaaggtgaagatcaacatccagcag
gagcacaaagacggcgccatcttcgcctgcaactcggttcccggctcgcagacctcgccc
gccgtcgccatcgagcgccgactcgacgaacgctacctcgctctccaggacgacggctcc
tcctatcgcgtccaggtctacaggtcgtcgggcttcgtgtcttcggagcagcagcagaac
ctgcgcctctacgttgtgaacaaggccaactatggcagcgacgaggccgacccggcgcag
ctccgcgacgagctggacatcaacaagatcggcgatcgcgatttcctggtcaaggcgtcg
gccagcaccaaggagatctaccagaacatcctgcggaaggcggccaggattcccggcccg
gtgatcgagtcctacgacgccgaggtaggcgagaagcgcatcgtcatctgctaccgccgc
ggcaccacgacccgcttcttcggtgccctgaccgacctctaccactaccacggcttcgtc
gcccgcaagaagttcgtcgagcagttcgccaacggtttcctcatcgtctgcctctacctc
accaccccggcctcccagcccgcccaagacgcggctgatgtgaacgcgcggatgcggttg
ttcgagaaggaggcgaacctgatctacatcctgccgtcgtcgcggatggcgtcgctgctg
caggccggtgagctgagcgaggaggagtgcgtgtacgcgcacgccgcgtggaagttcgcg
gcgcacttcatcaaccgcatgggctcggagtaccacgcgctgcgcaaggcgctcgacatg
cgcgacgagcgccacgcgggcctcatggccgcgctcaagcggcgcctggttaacgccacc
ttcaccgaacactcgatcggtgacgtcatcatggccaacccggccatggtaaagctcctc
taccgtgactttgcgcgcctccacaacccggccgacgccgacgcccaggccagcctccag
ctcggcgccgacgccctcgccgcccggcgcgacgaggtcctcgccgcgatcaagcgtcac
gccgccgcgtcggagcaggaccaggagatcttcggcatgttcctcaccttcaaccgccac
gtcgtcaagaccaacttctacaaggtcgacaaggtggccctctcgttccgcctcagcccc
gaattcctggacgaccaggagtacccccagcgaccctttggcattttctacatcatcggc
gacgaattccgcggattccacgttcggttttcggacgtagcgcgcggaggcgtgcgtatt
gtgcggtcgcgcgacacggagtcgtacgcgacgaacgcgcgccacatgttcgaggagtgc
tacgggctggccaacacgcaggagcggaagaacaaggacatccccgagggcgggtccaag
ggcgtgatcctgctcgacctcgccaaggccgcccacggccagcctcacaagcccgaacag
gccgagaacgccttcaagaaatacgtcgacagcattctcgacattcttctctccagccaa
gagacgaggcgggagcaggcgattgtggaccactacaagacggaggagatcctgttcctg
ggacccgacgagggcacggccgacgtgatggactgggcctcgcagcgggccaaggagcgg
ggcgcctcgttctggaaggccttcaccaccggcaagtcccgctccctcggcggcattcct
cacgacatgtacggcatgaccacgcgctcgatccaccagtacgtggtgggcatcctcgcc
aagctgggcatcgacgaagccgacgtcaccaagttccaaaccggcggacccgacggcgat
ctcggatcgaacgagatcaagatctcgcgggacaagaccatcggcatcgttgatggctcg
ggcgtgctgtacgacccgcagggaatcgaccgcgaggagctccgtcgcctggcggacgcg
cgcctcatggtgcgagagttcgaccgcgcccggctctccgccggcggcttcctcgtcgac
gtcaacgaccgcgaggtgacgctgcccgacggcaccgtcgtcgacaacggcctcaacttc
cgcaacgagttccacctcaacccgctctcgtcggccacgctcttcgtgccctgcggcggc
cgccccgaggccgtcaacatcagcaacgtcgacaagttcttccaccaccggcgctccacc
gccaccaccgccggcggcgctcccgagcgcgtgccgcggttcaagtacatcgtcgagggc
gccaacctgttcttcacgcaggaggcgcgcctcgtgctcgaggaggccggcgtggtgatc
ttcaaggacgccagcgccaacaagggcggcgtgacgtcgtcgtcgctcgaggtcctggct
gcgctggcgctcaaggacgacgagttcctggcccacatgaccgtccagaagtcagccgac
accggcgacgaggtggtgcccgacttctaccgccgctacatcgagaacgtccaccagatc
atcgaacgcaacgccgccctcgaattccaggccgtctgggatgcgaacaagcgaacgggg
ctgccgcgctcggtgatcgccgacctggtgtcgaccaagatcaacggcctcaacgttcag
atccaaaactccaacctgtggaccaaccaggccttcaagaacctggtgttggccgaggcc
tgccctccggtcctgttggagctggtgggtggcgtggcgggtctgtgccagcgcgtgccg
gagaactacctgcgtgccatcttcggcgcctacctcggcagccgctacatctaccggtac
ggcctcgagaccagggagttcgacttcttcgatttcgtgcagccctacttcgaccggatc
gccgcccagtaa

DBGET integrated database retrieval system