KEGG   Acanthamoeba castellanii: ACA1_069750Help
Entry
ACA1_069750       CDS       T02667                                 

Definition
hyaluronidase
Orthology
K15719  
protein O-GlcNAcase / histone acetyltransferase [EC:3.2.1.169 2.3.1.48]
Organism
acan  Acanthamoeba castellanii
Brite
Enzymes [BR:acan01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     ACA1_069750
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.169  protein O-GlcNAcase
     ACA1_069750
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
Unknown
AA seq 484 aa AA seqDB search
MAQMQKEERVFKISGIVEAFFGRLWSMDDRKSLVARFVPKGLNHYLYAAKEDPKQRKEWR
EPYTEEELGQFRDFIKFCSDKGVAFNYGISPQADLSHYDDERGFSSDVGQLANKLATFAE
LGCRNVTLFLEDLSAARQMARTKTPPQKGQQQLTVGLMHAKLANDLAKRVADVLKERLGD
KPAPRVNWYMCPTHSCGDFQALERGTEDKADQKKIKYWRDLNQALPTNWTLLFTGRTTVS
ANVTVEFAKSLSAFWKKRKLILLDNFPLNDYRPHILFLHAYQGREAGIENYFEGVLANPM
DRVEASTIPLTTVFDFLRDPAKYNHNTSLFGALNEVFENNSLNNLMVNLIQYYPSSPLCN
KEKIIELHKQRKVQKTEQQHLTHLNQGLDRVARFLQQSTDERRQRLFVELEPFFTLARAF
VVMNLTQYALEELLNSHTATESAIETTQLELTEAQRTLDALLFPSRPAKLLRQRLLELNE
RFCS
NT seq 1455 nt NT seq  +upstreamnt  +downstreamnt
atggcgcagatgcaaaaggaggagcgagtgtttaagatttcgggaatcgtggaggccttc
tttgggcggctgtggagcatggacgatcgcaaatcgctggtcgctcgattcgtccctaaa
ggcctcaatcactacctctatgccgccaaggaagaccccaagcaacgcaaggagtggcgt
gagccctacaccgaagaggaactgggccagttccgcgacttcatcaagttctgctcggac
aagggcgtcgccttcaactacggaatctcgccccaggcggatctgtcgcattacgacgac
gagcgcggcttttcgtcggacgtgggccagctggccaacaagctggccacgttcgccgag
ctgggctgccgcaacgtgactctcttcctcgaggacctgtccgccgcgcgccagatggcg
cgcaccaagacgccgccccagaaggggcagcagcagctcacggtgggcctcatgcacgcc
aagctggccaacgacctcgccaagcgggtggccgacgtgctcaaggagcggctgggcgac
aagccggcaccgcgggtcaattggtacatgtgcccaactcacagctgtggcgatttccag
gctcttgagcgtggcacggaggacaaggcagaccaaaagaagatcaagtactggcgagac
ctcaaccaagctctgcccaccaactggacgcttctctttacaggacggactaccgtcagc
gccaacgtcacggtcgagttcgccaagagcctctccgcgttctggaagaagcgaaagctc
atcctgctcgacaacttccctctgaacgactaccgaccgcacatcctgttcctgcacgcc
taccagggccgtgaagccggcatcgaaaattacttcgagggagtgttggccaaccccatg
gatagagtcgaagcgtccacaattccactcaccaccgtgttcgacttccttcgcgaccct
gccaagtacaaccacaacacgagcctctttggcgcgctcaatgaggtgtttgaaaacaac
agcctcaacaacctgatggtcaacctcatccagtactacccgtcctccccgctctgcaac
aaggagaagatcatcgaactccacaagcagcgaaaggtccagaagaccgaacagcagcac
ctcacacacctcaaccagggactggatcgagtggcgcgtttcctgcaacagagcacggac
gaaaggcggcagcgattgttcgtcgagctggaacccttcttcacactggcccgggccttc
gtggtgatgaacctcacccagtacgcgctcgaggaactgctcaactcccacaccgccacc
gagtccgccatcgagaccacgcagctcgagctcaccgaggcccagcgcaccctcgacgcc
ctgctcttcccgtcgcgccccgccaagctgctccgccagcggctcctcgagctcaacgag
cgcttctgctcatga

DBGET integrated database retrieval system