KEGG   Acanthamoeba castellanii: ACA1_075370Help
Entry
ACA1_075370       CDS       T02667                                 

Definition
amine oxidase, flavincontaining superfamily protein
Orthology
K00274  
monoamine oxidase [EC:1.4.3.4]
Organism
acan  Acanthamoeba castellanii
Pathway
Glycine, serine and threonine metabolism
Arginine and proline metabolism
Histidine metabolism
Tyrosine metabolism
Phenylalanine metabolism
Tryptophan metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:acan00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    ACA1_075370
   00330 Arginine and proline metabolism
    ACA1_075370
   00340 Histidine metabolism
    ACA1_075370
   00350 Tyrosine metabolism
    ACA1_075370
   00360 Phenylalanine metabolism
    ACA1_075370
   00380 Tryptophan metabolism
    ACA1_075370
Enzymes [BR:acan01000]
 1. Oxidoreductases
  1.4  Acting on the CH-NH2 group of donors
   1.4.3  With oxygen as acceptor
    1.4.3.4  monoamine oxidase
     ACA1_075370
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
Unknown
AA seq 510 aa AA seqDB search
MEGLDYDVVVVGAGLAGLRTTQLLVQQGLSVLCLEANNCVGGRTRSAVREGYRWDVGGQW
LGPTQTRMLNLCSQLGLATFPQYTEGKKWVDVLGKKKTYTGTIPPLTIASLIDIQLGIWK
IDALAKTVPKGRPQDCPNAREWDNMTVETWKHQNLWTDGAKAMWDIGVRAVYSSDPAELS
FLFFLHYIHCAGGYMVLLDTENGAQETRIRGSAHGVALKLAEQLGEQVRLASPVTSIHQT
ASNAAVTIQDGSSYTCHRVIITVPPLLTNRIEFEPALPTRRRHLAQRMPMGQVIKCLVFY
DRPFWRDSGFAGEVVTDGEGVSISFDASLPDIEQYALVAFFDGNPARQWSEKTKEERRAE
VVRTFVNYFGDEAAHPIDYLEQDWCSEPWVLGGYTGLMGPGVLTTCGETLTAPFGRIHWA
GTETATSWPGYMEGAVQSAERVTDEVLSALAGNVIEYPPPATLTPPPRGSGFPIGKTALA
LAGVSLCVGVMWAWDNKFTVVKNVVAFFVV
NT seq 1533 nt NT seq  +upstreamnt  +downstreamnt
atggagggactggactacgacgtggttgtggtgggcgccggtctggccggtctgcgcact
acgcagttgctcgtgcagcagggcctttcggtgctatgcctcgaagccaacaactgcgtt
ggcggccgcacccggagcgcggtgagggagggttaccgatgggatgtcggtggccagtgg
cttggccccacccagacccgcatgctcaatctctgctcccagctgggcctcgccaccttc
ccccagtacaccgagggtaaaaagtgggtggacgtgctgggcaagaagaagacgtacacg
ggcaccatcccgccgctcacgatcgcctccttgatcgacatccagctgggcatctggaag
atcgacgccctcgccaagaccgtgcccaaggggagaccgcaggattgcccgaatgcccgg
gagtgggacaacatgaccgtggagacgtggaagcaccagaacctctggaccgatggcgcc
aaggccatgtgggacatcggcgtgcgcgccgtctactcttccgacccggcagagctttcg
ttcctcttcttccttcactacatccattgcgccggcgggtacatggtgctccttgacacc
gagaacggcgcccaggagacccgaatccgaggctcggcccacggcgtagcgctcaagctc
gccgagcagctcggcgagcaggtccgactcgccagcccggtcacgagcatccaccaaact
gcatcgaatgccgcggtgacgatacaggacggctcgtcctacacctgccaccgtgtaatc
atcacggtgccaccactgctcaccaaccgcatcgaattcgagcccgcgctgcccacgagg
aggcgccatctggcgcagcggatgccaatgggccaagtcatcaagtgcttggtcttctat
gatcggcccttctggcgcgacagcggctttgcgggcgaggtggtgacggacggagagggc
gtgtcgatcagcttcgatgccagcctgcccgacatcgagcagtacgcgctggtggccttc
ttcgacggcaaccccgcgcgccagtggagtgaaaagacgaaggaggagaggagagccgaa
gtggtgcgcacctttgtgaactactttggagacgaggctgcccacccgatcgactacctc
gaacaggactggtgctcggagccgtgggtgctcggagggtacactggcctaatgggtccc
ggggtgctgacgacgtgcggcgagaccctcacagcgccgtttgggcgcattcactgggcc
ggaaccgaaaccgccaccagttggcccggctacatggagggtgcggtccagtcggctgag
cgggtgaccgacgaagtgctatctgcccttgccggtaacgtgatcgagtacccgccgccg
gccaccctgaccccgccaccccgaggcagcggattcccgatcggcaagaccgcgctcgcg
ttggccggagtgagcctctgcgtcggcgtcatgtgggcctgggacaacaagttcaccgtc
gtcaagaacgtcgtcgccttcttcgttgtgtga

DBGET integrated database retrieval system