KEGG   Acanthamoeba castellanii: ACA1_075370Help
Entry
ACA1_075370       CDS       T02667                                 

Definition
amine oxidase, flavincontaining superfamily protein
Orthology
K00274  
monoamine oxidase [EC:1.4.3.4]
Organism
acan  Acanthamoeba castellanii
Pathway
Glycine, serine and threonine metabolism
Arginine and proline metabolism
Histidine metabolism
Tyrosine metabolism
Phenylalanine metabolism
Tryptophan metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Amino acid metabolism; Glycine, serine and threonine metabolism [PATH:acan00260]
Metabolism; Amino acid metabolism; Arginine and proline metabolism [PATH:acan00330]
Metabolism; Amino acid metabolism; Histidine metabolism [PATH:acan00340]
Metabolism; Amino acid metabolism; Tyrosine metabolism [PATH:acan00350]
Metabolism; Amino acid metabolism; Phenylalanine metabolism [PATH:acan00360]
Metabolism; Amino acid metabolism; Tryptophan metabolism [PATH:acan00380]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
Unknown
AA seq 510 aa AA seqDB search
MEGLDYDVVVVGAGLAGLRTTQLLVQQGLSVLCLEANNCVGGRTRSAVREGYRWDVGGQW
LGPTQTRMLNLCSQLGLATFPQYTEGKKWVDVLGKKKTYTGTIPPLTIASLIDIQLGIWK
IDALAKTVPKGRPQDCPNAREWDNMTVETWKHQNLWTDGAKAMWDIGVRAVYSSDPAELS
FLFFLHYIHCAGGYMVLLDTENGAQETRIRGSAHGVALKLAEQLGEQVRLASPVTSIHQT
ASNAAVTIQDGSSYTCHRVIITVPPLLTNRIEFEPALPTRRRHLAQRMPMGQVIKCLVFY
DRPFWRDSGFAGEVVTDGEGVSISFDASLPDIEQYALVAFFDGNPARQWSEKTKEERRAE
VVRTFVNYFGDEAAHPIDYLEQDWCSEPWVLGGYTGLMGPGVLTTCGETLTAPFGRIHWA
GTETATSWPGYMEGAVQSAERVTDEVLSALAGNVIEYPPPATLTPPPRGSGFPIGKTALA
LAGVSLCVGVMWAWDNKFTVVKNVVAFFVV
NT seq 1533 nt NT seq  +upstreamnt  +downstreamnt
atggagggactggactacgacgtggttgtggtgggcgccggtctggccggtctgcgcact
acgcagttgctcgtgcagcagggcctttcggtgctatgcctcgaagccaacaactgcgtt
ggcggccgcacccggagcgcggtgagggagggttaccgatgggatgtcggtggccagtgg
cttggccccacccagacccgcatgctcaatctctgctcccagctgggcctcgccaccttc
ccccagtacaccgagggtaaaaagtgggtggacgtgctgggcaagaagaagacgtacacg
ggcaccatcccgccgctcacgatcgcctccttgatcgacatccagctgggcatctggaag
atcgacgccctcgccaagaccgtgcccaaggggagaccgcaggattgcccgaatgcccgg
gagtgggacaacatgaccgtggagacgtggaagcaccagaacctctggaccgatggcgcc
aaggccatgtgggacatcggcgtgcgcgccgtctactcttccgacccggcagagctttcg
ttcctcttcttccttcactacatccattgcgccggcgggtacatggtgctccttgacacc
gagaacggcgcccaggagacccgaatccgaggctcggcccacggcgtagcgctcaagctc
gccgagcagctcggcgagcaggtccgactcgccagcccggtcacgagcatccaccaaact
gcatcgaatgccgcggtgacgatacaggacggctcgtcctacacctgccaccgtgtaatc
atcacggtgccaccactgctcaccaaccgcatcgaattcgagcccgcgctgcccacgagg
aggcgccatctggcgcagcggatgccaatgggccaagtcatcaagtgcttggtcttctat
gatcggcccttctggcgcgacagcggctttgcgggcgaggtggtgacggacggagagggc
gtgtcgatcagcttcgatgccagcctgcccgacatcgagcagtacgcgctggtggccttc
ttcgacggcaaccccgcgcgccagtggagtgaaaagacgaaggaggagaggagagccgaa
gtggtgcgcacctttgtgaactactttggagacgaggctgcccacccgatcgactacctc
gaacaggactggtgctcggagccgtgggtgctcggagggtacactggcctaatgggtccc
ggggtgctgacgacgtgcggcgagaccctcacagcgccgtttgggcgcattcactgggcc
ggaaccgaaaccgccaccagttggcccggctacatggagggtgcggtccagtcggctgag
cgggtgaccgacgaagtgctatctgcccttgccggtaacgtgatcgagtacccgccgccg
gccaccctgaccccgccaccccgaggcagcggattcccgatcggcaagaccgcgctcgcg
ttggccggagtgagcctctgcgtcggcgtcatgtgggcctgggacaacaagttcaccgtc
gtcaagaacgtcgtcgccttcttcgttgtgtga

DBGET integrated database retrieval system