KEGG   Acanthamoeba castellanii: ACA1_075370Help
Entry
ACA1_075370       CDS       T02667                                 

Definition
(RefSeq) amine oxidase, flavincontaining superfamily protein
  KO
K00274  monoamine oxidase [EC:1.4.3.4]
Organism
acan  Acanthamoeba castellanii
Pathway
acan00260  Glycine, serine and threonine metabolism
acan00330  Arginine and proline metabolism
acan00340  Histidine metabolism
acan00350  Tyrosine metabolism
acan00360  Phenylalanine metabolism
acan00380  Tryptophan metabolism
acan01100  Metabolic pathways
acan01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:acan00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    ACA1_075370
   00330 Arginine and proline metabolism
    ACA1_075370
   00340 Histidine metabolism
    ACA1_075370
   00350 Tyrosine metabolism
    ACA1_075370
   00360 Phenylalanine metabolism
    ACA1_075370
   00380 Tryptophan metabolism
    ACA1_075370
Enzymes [BR:acan01000]
 1. Oxidoreductases
  1.4  Acting on the CH-NH2 group of donors
   1.4.3  With oxygen as acceptor
    1.4.3.4  monoamine oxidase
     ACA1_075370
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Amino_oxidase NAD_binding_8 DAO FAD_binding_2 Pyr_redox_2 FAD_binding_3 HI0933_like Lycopene_cycl FAD_oxidored Thi4 GIDA 3HCDH_N FMO-like GDI
Motif
Other DBs
NCBI-GeneID: 14924957
NCBI-ProteinID: XP_004353486
UniProt: L8HGX7
Position
Unknown
AA seq 510 aa AA seqDB search
MEGLDYDVVVVGAGLAGLRTTQLLVQQGLSVLCLEANNCVGGRTRSAVREGYRWDVGGQW
LGPTQTRMLNLCSQLGLATFPQYTEGKKWVDVLGKKKTYTGTIPPLTIASLIDIQLGIWK
IDALAKTVPKGRPQDCPNAREWDNMTVETWKHQNLWTDGAKAMWDIGVRAVYSSDPAELS
FLFFLHYIHCAGGYMVLLDTENGAQETRIRGSAHGVALKLAEQLGEQVRLASPVTSIHQT
ASNAAVTIQDGSSYTCHRVIITVPPLLTNRIEFEPALPTRRRHLAQRMPMGQVIKCLVFY
DRPFWRDSGFAGEVVTDGEGVSISFDASLPDIEQYALVAFFDGNPARQWSEKTKEERRAE
VVRTFVNYFGDEAAHPIDYLEQDWCSEPWVLGGYTGLMGPGVLTTCGETLTAPFGRIHWA
GTETATSWPGYMEGAVQSAERVTDEVLSALAGNVIEYPPPATLTPPPRGSGFPIGKTALA
LAGVSLCVGVMWAWDNKFTVVKNVVAFFVV
NT seq 1533 nt NT seq  +upstreamnt  +downstreamnt
atggagggactggactacgacgtggttgtggtgggcgccggtctggccggtctgcgcact
acgcagttgctcgtgcagcagggcctttcggtgctatgcctcgaagccaacaactgcgtt
ggcggccgcacccggagcgcggtgagggagggttaccgatgggatgtcggtggccagtgg
cttggccccacccagacccgcatgctcaatctctgctcccagctgggcctcgccaccttc
ccccagtacaccgagggtaaaaagtgggtggacgtgctgggcaagaagaagacgtacacg
ggcaccatcccgccgctcacgatcgcctccttgatcgacatccagctgggcatctggaag
atcgacgccctcgccaagaccgtgcccaaggggagaccgcaggattgcccgaatgcccgg
gagtgggacaacatgaccgtggagacgtggaagcaccagaacctctggaccgatggcgcc
aaggccatgtgggacatcggcgtgcgcgccgtctactcttccgacccggcagagctttcg
ttcctcttcttccttcactacatccattgcgccggcgggtacatggtgctccttgacacc
gagaacggcgcccaggagacccgaatccgaggctcggcccacggcgtagcgctcaagctc
gccgagcagctcggcgagcaggtccgactcgccagcccggtcacgagcatccaccaaact
gcatcgaatgccgcggtgacgatacaggacggctcgtcctacacctgccaccgtgtaatc
atcacggtgccaccactgctcaccaaccgcatcgaattcgagcccgcgctgcccacgagg
aggcgccatctggcgcagcggatgccaatgggccaagtcatcaagtgcttggtcttctat
gatcggcccttctggcgcgacagcggctttgcgggcgaggtggtgacggacggagagggc
gtgtcgatcagcttcgatgccagcctgcccgacatcgagcagtacgcgctggtggccttc
ttcgacggcaaccccgcgcgccagtggagtgaaaagacgaaggaggagaggagagccgaa
gtggtgcgcacctttgtgaactactttggagacgaggctgcccacccgatcgactacctc
gaacaggactggtgctcggagccgtgggtgctcggagggtacactggcctaatgggtccc
ggggtgctgacgacgtgcggcgagaccctcacagcgccgtttgggcgcattcactgggcc
ggaaccgaaaccgccaccagttggcccggctacatggagggtgcggtccagtcggctgag
cgggtgaccgacgaagtgctatctgcccttgccggtaacgtgatcgagtacccgccgccg
gccaccctgaccccgccaccccgaggcagcggattcccgatcggcaagaccgcgctcgcg
ttggccggagtgagcctctgcgtcggcgtcatgtgggcctgggacaacaagttcaccgtc
gtcaagaacgtcgtcgccttcttcgttgtgtga

DBGET integrated database retrieval system