KEGG   Acanthamoeba castellanii: ACA1_096970Help
Entry
ACA1_096970       CDS       T02667                                 

Definition
NADH cytochrome b reductase, putative
Orthology
K00326  
cytochrome-b5 reductase [EC:1.6.2.2]
Organism
acan  Acanthamoeba castellanii
Pathway
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:acan00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    ACA1_096970
Enzymes [BR:acan01000]
 1. Oxidoreductases
  1.6  Acting on NADH or NADPH
   1.6.2  With a heme protein as acceptor
    1.6.2.2  cytochrome-b5 reductase
     ACA1_096970
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
Unknown
AA seq 301 aa AA seqDB search
MALLLALSDFINLSDPTVIGGLIVGAITIFAVGRFLFASDSAQPAKKADNVVGKGKEVSK
DVPAARPAPVRTGVLDPSKFQKFALKERIELNHNTRLYRFALPNETDVLGLPIGQHMSFR
AVIDGKEVYRPYTPTSSDDDLGHFDLVYPQGKMSQYIDNMKVGELIDVKGPKGLFTYTPN
MKRAFGMLAGGTGITPMLQVIQAILKNPADRTQVSLIFANVAEDDILVRSTLEDLAAKNP
DRFKLHYTLDKGFITADMVAEHCPAPADDVMILMCGPTPMVNAQIGNLQKLGYSENQYFK
F
NT seq 906 nt NT seq  +upstreamnt  +downstreamnt
atggctctcctgctggctctctccgatttcatcaatctgtctgatccgaccgtcatcggc
ggcctcatcgtcggcgctatcaccatctttgccgtcggtcggttcttgttcgcctccgac
agcgcccagccggccaagaaggctgacaatgtagtcggcaagggtaaagaggtgtccaag
gatgtgcccgctgcccggcccgctcctgtccgcaccggcgtcctcgacccctccaaattc
cagaagtttgcgctcaaggagaggatcgagctcaaccacaacactcgcctgtaccgattc
gccctgcccaacgagaccgacgttctcggcctgcccatcggccagcacatgtcgttcagg
gctgtaattgatggcaaggaggtctaccgcccctacacgcccacttcctctgacgacgac
ctcggtcacttcgatcttgtctaccctcagggcaagatgtcgcagtacattgacaacatg
aaggtcggcgagctgatcgacgtgaagggtcccaagggtctgttcacctacacgcccaac
atgaagcgcgccttcggcatgcttgctggtggcaccggcatcacaccgatgctgcaggtc
atccaggccatcctcaagaaccccgctgaccgcacccaggtctctctcatcttcgccaat
gtcgccgaggacgacatcctcgtgcgttccaccctcgaggacctcgcggccaagaacccc
gaccgcttcaagctccactacactcttgacaagggcttcatcacggccgacatggtggcc
gagcactgcccggcccctgcggacgatgtcatgatcctcatgtgcggcccgacccccatg
gtcaacgcgcagatcggcaatctgcagaagctcggctacagcgagaaccagtacttcaag
ttctaa

DBGET integrated database retrieval system