KEGG   Acanthamoeba castellanii: ACA1_109790Help
Entry
ACA1_109790       CDS       T02667                                 

Definition
glutamate5-semialdehyde dehydrogenase
Orthology
K12657  
delta-1-pyrroline-5-carboxylate synthetase [EC:2.7.2.11 1.2.1.41]
Organism
acan  Acanthamoeba castellanii
Pathway
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of amino acids
Module
Proline biosynthesis, glutamate => proline
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:acan01230]
Metabolism; Amino acid metabolism; Arginine and proline metabolism [PATH:acan00330]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
Unknown
AA seq 751 aa AA seqDB search
MSARREFQSKKRILIKAGTGVITDESGGVSLGRFGHLVEQVAELKKRGKEVIIVSSGAVA
MGKQKLHESAAPPSHNPRACAAAGQSGLMALYETLFRQKDIWHILLTDEDFLNEERRSNF
RETVDELIRLGAVPILNENDVISSRKTPYTDSEKRIFWTSPYPPHAAAAAAAAAFKHSSV
PPLTNQTKPNQQDNDSLAALVAGETNADLVILLSDVEGLYKEPPSASGKKGELIDTYQHD
AKFTIGAGSRTGRGGMQAKIEAARYALSRGAFAVVIASGYTLNVITNIVAGARIGTLFVE
HPERELATARQMASCSRKAAQALLALGPQRRQALLGAIATNLTAAKAQILEANQRDIANA
RENNLRPALAARLVLDDKKLHTLASGVRQIAAGEDPIGKVLKRRELADGLVLEEVRVPIG
VLLVIFEARPDVLPQVAALAIRSGNGLILKGGKEALHTNTVLHGIITRTVEQFGVDPQLV
GLVQTYEQIDELLQLKEIDLVIPRGSAELVSHIQHNTRIPVLGHSEGLCHVYVDQAADLD
KATRIAVDSKTDYPAACNAAETLLLHRDLLADRRAHAVLDALARANVKLYAAPHAATHFP
DLPRAQSLRTEYSDLGMTVEVVDSLEAAIAHVNEYGSGHTDAIITEDKEAAQKFSQFVNS
ACVFHNASTRFSDGYRFGLGAEVGISTSRIHARGPVGIEGLLSSKWVLVSQTGGSVASDF
SAGKRTFTHRDIYPPFAPQPASVFADFQPKL
NT seq 2256 nt NT seq  +upstreamnt  +downstreamnt
atgagcgcgaggcgagagttccaatcgaagaagaggatcctgatcaaggccggcaccggc
gtcatcaccgacgagagcgggggtgtgtcgctgggacggttcggccacctcgtggagcag
gtggcggagctcaagaagcgcggcaaggaggtaatcattgtgagcagcggggccgtcgcc
atgggcaagcagaagctgcacgagagcgccgccccaccctcccacaacccgcgggcgtgc
gccgccgccggccagagcggcctcatggccctctacgaaaccctcttccgccagaaggac
atatggcacatcctcctcaccgacgaagacttcctcaatgaggagcgaaggtccaacttt
cgcgagacggtggacgagctcatcaggctgggcgcggtgcccatcctcaacgaaaacgac
gtcatcagctcccgcaagaccccctacacggactcggagaagcgcatcttctggacctct
ccctatcctcctcatgctgctgctgctgctgctgctgctgctttcaagcactcgtctgtt
cctccgctcaccaaccaaaccaaaccaaaccaacaggacaacgacagcctggcggcgctc
gtggccggagagacgaacgccgatctcgtcatcctcctcagcgacgtggagggcctctac
aaggagcccccgagcgcctccggcaagaagggcgaactcattgacacctaccagcatgac
gccaagttcaccatcggcgctggctcccgcactgggaggggcggcatgcaggccaagatc
gaggccgcgcggtacgccctctcgcgcggggccttcgcggtggtgatcgccagcgggtac
acgctcaacgttatcaccaacatcgtggcgggcgcgcgcatcggcaccctcttcgtggag
catcccgagcgggagctggccacggcgcgccaaatggcgtcgtgctcgcgcaaggccgcc
caagccctgctcgcgctgggtccgcaacggcgtcaggccctgctgggggccatcgccacc
aacctcacggcggccaaggcccagatcctggaggccaaccagcgcgacatcgccaacgcc
cgcgagaacaacctgcgccccgccctcgccgcacgcctcgtcctcgacgacaagaaactc
cacaccctcgccagcggagtgaggcagatcgcggcgggcgaggatccgatcggcaaggtg
ctgaagcggcgggagctggccgacgggctggtgctggaggaggtgcgtgtgccgatcggg
gtgctgctggtgatcttcgaggcgcggccggacgtgctgccgcaggtggcggcgctggcc
atccggtcgggcaacgggctcatcctcaagggtgggaaggaggcgctgcacacgaacacg
gtgctgcacggcatcatcacgcgcaccgtggagcagttcggggtggacccgcagctggtg
ggcctcgtgcagacctacgagcagatcgacgagctcctgcagctcaaggagatcgacctc
gtcatcccgcgcggctcggccgagctcgtgagccacatccagcacaacacgcgcatcccc
gtgctgggccactccgagggcctctgccacgtgtatgtcgaccaggccgccgacctcgac
aaggccacccgcatcgccgtcgactccaagaccgactacccggccgcctgcaacgccgcc
gagaccctcctcctccaccgcgacctcctcgccgaccgacgcgctcacgccgtcctcgac
gccctcgcccgcgccaacgtcaaactctacgccgcgccccacgccgccacccacttcccc
gacctcccccgcgcgcagtccctgcgaacagagtattcggacctgggcatgaccgtggag
gtggtcgacagtctcgaggcggccattgcccacgtcaacgagtacggcagcggccacacg
gacgccatcatcaccgaggacaaggaggccgcacagaagttctcccagtttgtcaactcg
gcctgcgtattccacaacgcgagcacgcgcttctccgacggctaccgattcgggttgggt
gccgaggtgggcatcagcaccagccgcatccacgcgcgaggacccgtgggtatcgagggg
cttctgtcgagcaagtgggtcctggtgtcacagaccggaggctccgtcgcgtcagacttc
tcggcgggcaagcgaaccttcacgcaccgcgacatctacccgcccttcgccccgcagccc
gcctccgtctttgccgacttccagcccaagctgtaa

DBGET integrated database retrieval system