KEGG   Acanthamoeba castellanii: ACA1_110070Help
Entry
ACA1_110070       CDS       T02667                                 

Definition
acetyltransferase, GNAT family
Orthology
K07739  
elongator complex protein 3 [EC:2.3.1.48]
Organism
acan  Acanthamoeba castellanii
Brite
Enzymes [BR:acan01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     ACA1_110070
Transfer RNA biogenesis [BR:acan03016]
 Eukaryotic Type
  tRNA modification factors
   Elongator complex
    ACA1_110070
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
Unknown
AA seq 487 aa AA seqDB search
MGCKTSPRQWKSSPPSRSNFIAVVAVMCKPHRCPHIAMTGNICVYCPGGPDSDFEYSTQA
YTGYEPTSMRAIRARYNPYLQTRNRIDQLKRLGHSVDKVEFIIMGGTFMSLGEDYRDYFI
RNLHDALSGHTSNSVAEAVRFSEQSGVKCIGITIETRPDYCLKPHLSAMLSYGCTRLEIG
VQSVYEDVARDTNRGHTVRAVNECFQLAKDCGFKVVAHMMPDLPNMGMERDMNGFMEFFE
NPAFRTDGLKLYPTLVIRGTGLYELWKTGQYKNYHPDALVDLVAKILALVPPWTRVYRIQ
RDIPMPLVTSGVENGNLRELALKRMEDFGTKCRDVRTREVGIKDIHHRVRPDQVELVRRD
YVGNGGWETFLTYEDPKQDILIGLLRLRKASEATFREEFKACPTSIVRELHVYGTVVPIH
NRDPTKFQHQGFGTLLMEEAERIALEEHGSEKISVISGVGTRHYYRKLGYELDGPYMSKM
LPGVKSF
NT seq 1464 nt NT seq  +upstreamnt  +downstreamnt
atgggctgcaagaccagcccaagacagtggaaatcatcgccgccatcccggagcaatttc
atcgcggtggtggctgtgatgtgcaagccgcacaggtgcccgcacattgcgatgacgggc
aacatctgcgtctactgcccggggggtccagactcggactttgagtactcgacgcaggcc
tacacgggctacgagcccacgtccatgcgggccatccgtgcccggtacaacccctatctc
cagacccgcaatcgcatcgaccagctcaagcggttgggccattcggtggacaaagtggag
ttcatcatcatgggcggcaccttcatgtctctcggggaggactatcgcgactacttcatc
cgcaacctccacgacgccctctccggccacacctccaacagcgtggccgaggccgtccgc
ttctcggagcaaagcggcgtcaagtgtatcggcatcaccatcgaaacccgccccgactac
tgcctcaagccccacctctccgccatgctctcctacggatgcacccgcctcgagatcggc
gttcagtccgtctacgaggacgtggcgcgcgacaccaatcgagggcacaccgtgagggcg
gtcaatgagtgctttcagctggccaaggactgcggattcaaagtggtggcgcacatgatg
cccgacttgcccaacatgggcatggagagggacatgaacggcttcatggagttctttgag
aatccggcgttccgcacggacggactcaagctttatcctacgctggtgattcgcgggacg
gggctctacgagctgtggaagacgggccagtacaaaaactaccaccccgacgccctggtg
gacctggtggccaaaatcctggccctggttcctccgtggacgcgcgtgtaccgcatccaa
cgggacatccccatgcccctggtcacctcgggcgtcgagaacggaaatctgcgcgagctg
gcgctcaagcgtatggaggactttggcaccaagtgccgcgacgtgcgcacccgcgaggtc
ggcatcaaggacatccatcaccgcgtccggcccgatcaggtggagttggtccggcgggac
tacgtgggcaacggtggctgggagaccttcctcacttacgaggatcccaagcaggacatt
ctcatcggcctgctccgcctgcgcaaggcatccgaggccactttcagagaggagttcaag
gcgtgtcctacttccatcgtgcgggagctgcatgtgtacggcaccgtagtgccgatccac
aaccgcgatcccaccaagttccagcaccagggctttggcacacttctgatggaggaagcg
gagcgcattgcattggaggaacatggatcagagaagatatcagtcatctcgggcgtgggc
acacgacactactaccgcaagcttggctatgaattggatggaccctacatgtccaagatg
ctgcctggggtcaagagcttctag

DBGET integrated database retrieval system