KEGG   Acanthamoeba castellanii: ACA1_114820Help
Entry
ACA1_114820       CDS       T02667                                 

Definition
glucosylceramidase
Orthology
K17108  
non-lysosomal glucosylceramidase [EC:3.2.1.45]
Organism
acan  Acanthamoeba castellanii
Pathway
Other glycan degradation
Sphingolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:acan00001]
 Metabolism
  Lipid metabolism
   00600 Sphingolipid metabolism
    ACA1_114820
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    ACA1_114820
Enzymes [BR:acan01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.45  glucosylceramidase
     ACA1_114820
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
Unknown
AA seq 860 aa AA seqDB search
MIHCFISGQQEEGERIKVPESTRERAQMPTATDALWQRRLSEQPTRQLRPLTAPLLHTLR
NLPLGFRLWRQAREERGGRDPVLDASGGQASSSGLPAGGMGGGCVGRSWRGDFEPGLILP
NGRGQAPVVPANQFSVFIEPDGEDSEATVLNPGIPPTDRLGAWDWSFVGEESYYSALFPR
AWTVYDEPEPRLRLTSRQISPVIGNNYKESSLPACVFVWTLENLDQEDEITASLMFTWQN
GTGAASDALGGHANTPFTRPHPERVVMDHTQWRVDERGGKTHASSEPLSFAIAASSPDSD
AHITVRSCWATNSDGAEVWKDFKRSGALEENWDALGKASQEGQTLGAAIAVRVTIPPGEH
RQVEFALAWDHPVVEFGAGRRYTRRYTRFYSQHGDSAAQLACDALVQYPQWERLIEQWQA
PILDDKRLPGCGGTVWLQDELSAKEEKPRREKRETDGQEEEQSDVGRWACLESQEHRLYN
ASDALFYASFALIANWPQLQLALQREVAAATLREDSRMVDVLATGRQAPNKVRGAVPYDM
GTPADDPWVALNAYNIHETSSWKGKLGLLPASHLSPSTELTEAADLNSKFVLGVYRDFVA
TQDKRFLADVWPAVDAALRHLQQFDRNKDGMIENEGLPDQTYHSWTGGLWVAALSAACAM
AQALQLADDSVAQHYRDLHQSAARVYNESLWNPSGYFNYDTSTSTHHDSIQADQLCGQWY
ARACGLPSIAPDKRIVTALKTVFANNFNEGKRGAVNGMRPDGRVDYACLHSSEAWPGTTF
ALAACMMGEGLVDQAFITAAGVCGSIYEDLGYWFRTPEAWDGSGNYRALGHMRPLAIWAM
QWAWTQRNHRLSSASTPTSS
NT seq 2583 nt NT seq  +upstreamnt  +downstreamnt
atgatccactgcttcataagtgggcagcaggaggagggggagaggatcaaggtgcccgag
agcacgagggagcgcgcccagatgccgaccgccaccgacgccctctggcaacggcggctg
agcgagcagcccacccgccaactgcgccccctcaccgcaccgctactccacaccctacgc
aacctgcccctcggcttcaggctgtggcgacaggcgcgcgaggagcgcggcgggcgcgat
ccggtattggacgcgagcggcgggcaggcgagcagcagcggactgccggcgggcggcatg
ggcggcggctgcgtgggccgcagctggcgcggcgacttcgagccgggcctcattcttccc
aacggccgcggccaggcgccagtcgtgcccgccaaccagttctccgtcttcatcgagccc
gacggcgaggacagcgaggccacggtgctcaacccgggcatacctccgaccgaccggctg
ggtgcgtgggactggtcgttcgtgggcgaggagagctactacagcgcgctcttccctcgc
gcgtggaccgtctacgacgaacccgagccgcggctgcgcctcacctctcgccagatctca
cccgtcataggaaacaactacaaagagagcagcttgccggcgtgcgtcttcgtgtggacg
ctcgagaacctggaccaggaggacgagatcaccgcgtcgctcatgttcacctggcagaac
ggcaccggcgccgcctccgacgcgctgggcggccacgccaacacccccttcacccgaccg
caccccgaacgtgtggtgatggaccacacgcagtggcgcgtggacgagcgtggagggaag
acgcacgcctcgagcgagccgctgtcgttcgccatcgccgcgtcgtcgcccgacagcgac
gcgcacatcaccgtgcgctcgtgctgggccaccaactcggacggggccgaggtgtggaag
gacttcaagcggagcggcgcgctggaggagaactgggacgccctgggcaaggcctcgcag
gagggccagacgctcggcgccgccatcgccgtccgcgtgacgatcccacccggcgaacac
agacaggtggagtttgcgctggcgtgggaccatcctgtggtggagttcggagcgggtcga
cgctacacgcggcgctacacccgcttctactcgcagcacggcgacagcgcagcgcagctg
gcctgtgacgccctcgtgcagtacccgcagtgggagcgcctcatcgaacagtggcaggcc
ccgattctcgacgacaaacgccttcccggctgcggcggcacggtgtggctgcaggacgaa
ctttcggcgaaggaagagaagccacgacgagagaagcgcgagaccgatggccaagaggaa
gagcagagcgacgttggccgctgggcgtgcctggagagccaagagcaccggctctacaac
gccagcgatgccctcttctacgcctcgtttgcgctcatcgccaactggccgcagctgcag
ctcgccctgcagagagaggtcgccgcggcgacgctgcgcgaggacagcagaatggtggac
gtgttggccaccggcaggcaggcgcccaacaaggtgcgaggagcggtgccgtacgacatg
ggcacgcccgcagacgacccctgggtggcgctcaacgcctacaacatacacgaaacctcc
tcttggaagggtaagctgggccttctcccggcttcgcacctctcaccttccaccgagctc
accgaagccgcagatctgaacagcaagttcgtgctcggggtctaccgcgactttgtggcg
acgcaggacaagcgcttcctggccgatgtgtggcccgcagtcgacgccgccctccgccac
ctccagcaattcgacaggaacaaggacggaatgatagagaacgagggcctgcccgaccaa
acctaccacagctggaccggtggtctgtgggtggcggccctgagcgcagcgtgcgccatg
gcccaggcactgcagctggccgacgactcggtcgcccagcactaccgcgacctgcaccaa
tccgcggcccgcgtctacaacgagtccttgtggaaccccagcggctatttcaactatgac
acgtcgacgagcacgcatcacgacagcatccaggccgatcagctctgcgggcagtggtac
gctcgagcgtgcggcctgccctccatcgcgccggacaagcggatagtcaccgcactcaag
accgtctttgccaacaacttcaacgaaggcaagcgaggggcggtcaacggcatgcgaccg
gacggcagagtcgactacgcgtgcctgcactcctccgaggcgtggcccggtacgacgttc
gcgctggcggcgtgcatgatgggcgaagggctggtcgaccaggccttcatcaccgctgcc
ggcgtctgcgggtccatctacgaagacctgggctactggttccgcacgcccgaggcgtgg
gatgggagcggcaactatcgagccctgggccacatgcgaccgctcgccatctgggccatg
caatgggcctggacccagcgcaatcaccgcctctcttctgcctccacaccaacgtcttca
tga

  All links  
No link information was found.   
DBGET integrated database retrieval system